SecReT6
Protein ID: 119943810
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0016
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]22319..22966 [+]
Producthypothetical protein
NoteTssL
UniProt IDA1SQX6
KEGG IDpin:Ping_0016
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.20E-38, Aligned region: 1..201
Protein Sequence: 215 a.a.     [Download]
>gi|119943810|ref|YP_941490.1| unnamed protein product [Psychromonas ingrahamii 37]
MKLIDKFIPVFQVIKHLPQNISDDSDITLIDLEQQFKTLLSNVKCSGYSKEQNQHALFSVCALVDEIILD
SEWKYRNEWAKSPLQKKYFDTHKAGTQFYEILDTLNENDIKDQDVREVFLYSLVQGFSGCYFESGEESVK
QEIIQANYALLSKDIKINLFSPPIPIRRLNQISNANRKKQKELLTIFGPIGVLLLSYFLLRSNILDSVSQ
ILSQI
 
Nucleotide Sequence: 648 bp     [Download]
>gi|119943794|ref|NC_008709.1|:22319-22966 Psychromonas ingrahamii 37 chromosome, complete genome
ATGAAACTAATAGATAAATTTATTCCTGTTTTTCAAGTAATTAAACATCTACCTCAAAACATATCTGATG
ATTCAGATATAACATTAATAGATCTCGAGCAACAATTTAAAACGTTATTATCTAATGTTAAGTGTTCTGG
TTATTCAAAAGAGCAGAATCAACATGCTCTATTTTCAGTTTGCGCACTGGTTGATGAAATTATTTTAGAT
TCAGAGTGGAAGTATAGAAATGAATGGGCAAAATCCCCATTACAAAAAAAATATTTTGATACACATAAAG
CAGGTACTCAGTTTTATGAAATTCTTGATACTTTAAATGAAAATGATATTAAAGACCAAGATGTAAGGGA
AGTCTTTCTTTACTCATTAGTTCAAGGCTTTTCCGGTTGTTATTTTGAGAGTGGAGAAGAGAGTGTTAAG
CAAGAAATTATTCAAGCAAATTATGCTCTTCTATCAAAAGATATAAAAATAAACTTATTTTCGCCACCGA
TTCCTATCCGTCGCCTTAATCAAATAAGTAACGCTAATAGAAAAAAACAAAAAGAGTTGCTCACAATATT
TGGTCCAATAGGAGTTCTTCTTTTGTCGTATTTTTTATTGAGAAGCAATATTCTTGATAGTGTTTCCCAA
ATCTTAAGCCAGATATAA
 Primer design