SecReT6
Protein ID: 119943811
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0017
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]22981..26403 [+]
Producthypothetical protein
NoteTssM
UniProt IDA1SQX7
KEGG IDpin:Ping_0017
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.50E-17, Aligned region: 175..359
DUF1215 [PF06744], Evalue: 3.20E-06, Aligned region: 273..309
DUF1215 [PF06744], Evalue: 3.20E-06, Aligned region: 937..988
Protein Sequence: 1140 a.a.     [Download]
>gi|119943811|ref|YP_941491.1| unnamed protein product [Psychromonas ingrahamii 37]
MKKFLKFLLVVFIWLVIFGVCVAGSLLLGATEVEGIQVFLAIFIAWYAIKFCIYLYKRWQAKQRVEKLIN
IDASTKEKTKLSFFQFLFPKSIDKHIKRVLKRINHNVSSDENQQEADFIMHIKMDNKHADWLYTETVNRP
QIADPIFSEYKYLQWIVLNDLVILDVDSYLIKNADSAANSEWLQLLNGLASSEKSKSLDGLLISIHVADL
VDPATRSQIADQLRKKYEEIKEYCGVEVPVNISLLGLEERKGVDDWLGQLSNDWKKQTLGVINQQKEPVK
NIIQSCFSKIQAIFKQGSLDYIVNQGFDETVANLPHKIKDIQDSVELFCSRLFSSNSFQGKPVCSGLFLV
MAEKNKAVFVDDLLEQSALCWLPAISMNKNTASDIEKNKRLWTYLSATTVLVILLGTLYNSDKNNIEQIY
QDYESQLSKSEDQVKVRDNLESRYQLITKLNDVNISYWLPLSESVFNIPTLKAELANDIQDVLISPVDKY
FEDNIKQLSNKNIDSKVDYLNILMRRINVLSAASKGASLTDLAELPQPFDSAYIDNMSPDMIDGLNSLYI
KSLFMIKDANDASYLKNWQQQITKYRNDISTLLLSSNGTMDWLIDWVNHNGKVDSVQLSDYWQGSRHIQS
PILIEGAYTLAGKTIIDDFSEQILYALGEEHPFLLKFLPVFQQQYQHNYVAKWGAFLKNFHTGTATLSSR
SEWLNVINNLTTGRNIFFKLLNDADYQLAPFNDLEDKPDWFDFSLYYQDMLALGEDEAQSNPAKNKVFTK
LALKVVGSLGPVGKAISGSGKKALKTKKKLDKASGSGPGPSERALNLQEAGKGLDEYKGLIADLVFNIEQ
QKESHKSIRAFFEFENNPIDEGTVLANAKLNIMNLQGLIGKAGNSTASFWNVYIGSILVLENFMLEESAC
LLEKSWEEDFLYELEGVPAYKLDEFAYGESGVLWSFFDKTLQPFIQNKRGGGYSFKKVVEKKIPLSPDLL
DYLIRAKDLKTRQKFKSFDLFMTAKPTDTNANSLLYVSETDISLICEAETQTLVNKNYIVNKLFKWDETC
RSVSLKLKVGNKILEKVYSGDDGVFNFLDDFKSGVKRFELEEFPVYFYELNSYRIEYFDVKLNIKGADRL
RQALSIKPPQPPESIAQCWM
 
Nucleotide Sequence: 3423 bp     [Download]
>gi|119943794|ref|NC_008709.1|:22981-26403 Psychromonas ingrahamii 37 chromosome, complete genome
ATGAAAAAATTCCTTAAGTTTTTACTCGTCGTTTTCATTTGGTTAGTCATATTTGGTGTTTGTGTGGCTG
GATCTTTATTGTTAGGTGCCACTGAAGTTGAAGGTATACAAGTTTTCTTGGCTATTTTCATCGCCTGGTA
TGCTATTAAGTTTTGCATCTACCTTTATAAGCGCTGGCAAGCAAAACAACGAGTTGAAAAATTAATTAAT
ATTGATGCGTCAACAAAGGAGAAAACAAAATTATCATTTTTTCAATTCTTATTTCCTAAATCCATTGATA
AGCATATTAAACGCGTCCTAAAGAGAATTAACCACAACGTCAGTAGCGATGAAAATCAGCAGGAAGCTGA
TTTTATTATGCATATTAAAATGGATAATAAACATGCTGACTGGTTATACACTGAAACAGTCAATAGACCT
CAAATAGCCGATCCAATTTTCAGTGAATATAAATATCTTCAATGGATTGTGCTAAATGATCTTGTGATTC
TAGATGTTGACTCTTATTTAATTAAAAATGCTGATTCTGCCGCTAACAGTGAATGGCTGCAATTACTCAA
TGGCTTAGCATCAAGCGAAAAATCAAAATCCTTAGACGGATTATTAATATCGATTCATGTTGCTGATTTA
GTTGATCCTGCAACGAGAAGCCAGATTGCAGATCAACTTCGAAAAAAATATGAAGAAATTAAAGAGTATT
GTGGTGTAGAAGTTCCTGTGAATATTTCACTTCTTGGATTAGAAGAGCGAAAAGGAGTTGATGACTGGCT
AGGACAACTGAGTAATGATTGGAAAAAGCAAACCTTAGGCGTTATTAACCAACAAAAAGAGCCGGTGAAA
AATATTATCCAAAGCTGTTTTTCGAAAATTCAAGCTATTTTTAAACAAGGATCTTTAGATTATATTGTTA
ATCAAGGGTTCGATGAAACCGTTGCCAATCTGCCTCATAAAATCAAAGATATTCAAGACTCTGTCGAGTT
ATTCTGCTCGCGTTTATTTTCAAGCAATAGTTTTCAAGGCAAACCTGTTTGTTCAGGTCTGTTTCTTGTT
ATGGCAGAAAAGAACAAAGCTGTATTTGTTGATGATCTGTTAGAGCAATCAGCTTTATGTTGGTTGCCTG
CTATATCAATGAATAAAAATACTGCCAGTGATATTGAAAAAAACAAACGGTTATGGACTTATTTATCTGC
AACAACAGTGCTAGTTATTCTGTTGGGGACTTTGTATAACTCCGATAAAAATAATATTGAGCAAATATAT
CAAGATTACGAATCGCAACTTTCAAAGTCTGAAGATCAAGTCAAAGTTAGGGACAATCTTGAGAGTAGAT
ATCAATTAATTACCAAACTAAATGACGTTAATATAAGTTATTGGCTACCCCTTTCAGAGAGTGTTTTTAA
TATACCTACATTAAAAGCTGAACTGGCTAATGATATTCAGGATGTTTTAATTTCTCCGGTCGATAAGTAC
TTTGAAGATAATATTAAACAATTATCGAATAAGAATATTGATAGTAAAGTTGATTATTTAAACATATTAA
TGCGCAGAATAAATGTGCTAAGTGCAGCAAGTAAAGGGGCTTCATTAACAGATTTAGCTGAATTGCCTCA
GCCCTTTGACAGCGCGTATATTGATAACATGTCACCAGATATGATTGATGGATTAAACAGTTTATATATT
AAAAGCTTGTTTATGATAAAGGATGCAAATGACGCAAGCTATCTCAAAAACTGGCAGCAGCAAATAACAA
AATATCGTAATGATATTTCTACCTTATTATTATCTTCTAATGGAACAATGGACTGGTTAATTGACTGGGT
TAATCATAATGGAAAAGTTGATTCGGTACAGCTGAGTGACTACTGGCAAGGTTCTAGGCATATCCAATCA
CCTATCTTAATTGAAGGTGCCTATACGTTAGCAGGTAAAACAATTATTGATGATTTTTCAGAGCAAATTT
TATATGCTCTAGGAGAGGAACACCCGTTTTTGTTAAAATTTTTACCTGTATTTCAACAGCAATATCAGCA
TAATTATGTCGCAAAATGGGGGGCTTTCTTAAAAAATTTCCATACAGGAACGGCAACATTGAGTAGCCGA
TCAGAATGGTTAAATGTTATTAATAATTTGACCACCGGACGAAATATTTTTTTCAAGTTATTAAATGATG
CGGATTACCAATTAGCTCCTTTTAATGATTTAGAGGATAAGCCCGATTGGTTTGATTTTTCCCTTTATTA
CCAAGATATGCTGGCCCTAGGTGAAGATGAAGCCCAATCTAACCCTGCAAAGAACAAAGTATTTACCAAG
TTAGCGTTAAAGGTGGTGGGATCATTAGGTCCTGTTGGTAAGGCTATTTCAGGTTCTGGGAAAAAGGCGT
TGAAAACCAAGAAAAAATTGGATAAAGCCAGTGGTTCTGGTCCAGGCCCTTCAGAAAGAGCGTTAAATTT
ACAAGAAGCCGGCAAAGGCTTGGATGAATATAAAGGGCTGATTGCGGATTTAGTGTTCAATATTGAACAG
CAAAAAGAGTCGCACAAAAGCATTCGCGCATTTTTTGAGTTTGAAAATAACCCGATAGACGAAGGCACTG
TTTTAGCAAATGCGAAACTTAACATCATGAACCTGCAGGGGTTAATAGGTAAAGCGGGTAATTCCACGGC
ATCATTTTGGAATGTGTACATTGGATCTATTTTAGTGCTAGAAAACTTTATGCTTGAAGAAAGTGCATGT
TTGCTTGAAAAATCATGGGAAGAAGATTTTCTCTATGAATTAGAAGGGGTACCGGCCTATAAGCTAGATG
AGTTTGCTTATGGGGAATCAGGTGTTTTATGGTCATTTTTTGATAAAACCTTACAACCTTTTATTCAAAA
TAAGCGCGGAGGGGGTTATAGTTTCAAAAAAGTGGTGGAGAAAAAAATTCCTTTGTCACCGGATTTATTA
GATTACTTAATTCGAGCTAAAGACTTAAAAACACGTCAGAAGTTTAAATCCTTTGATTTATTTATGACGG
CAAAACCAACAGATACAAATGCAAACTCACTATTATATGTATCAGAAACCGATATCAGCCTGATTTGTGA
AGCAGAAACACAAACACTGGTAAATAAGAATTATATCGTCAATAAGCTTTTTAAATGGGATGAAACATGT
CGTTCTGTTAGTTTAAAGCTAAAAGTGGGTAACAAGATACTTGAGAAAGTTTACAGTGGTGATGACGGTG
TATTCAATTTCTTGGATGATTTTAAATCTGGTGTTAAACGCTTTGAATTGGAAGAGTTTCCCGTATATTT
TTATGAATTAAACAGTTATCGAATTGAATACTTTGACGTTAAATTAAATATCAAAGGTGCCGATAGGTTA
AGACAAGCGTTATCTATCAAACCACCACAACCGCCTGAATCAATCGCGCAATGTTGGATGTAA
 Primer design