SecReT6
Protein ID: 119943813
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0019
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]28101..28589 [+]
Producthypothetical protein
NoteTssD
UniProt IDA1SQX9
KEGG IDpin:Ping_0019
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.00E-34, Aligned region: 6..146
Protein Sequence: 162 a.a.     [Download]
>gi|119943813|ref|YP_941493.1| unnamed protein product [Psychromonas ingrahamii 37]
MEFSGYMKIEGDIQGVIEGSSIRKNRETSIDLFSFKHEIKLPTNVQSGMGNGPVIHQPIVLLKEVDKSTP
KLYRALVEKERLNTVEFEWFRYTAQGEELVYYRIELINAHIISISPWTPALEKAESEYLRFMENVTLAYE
GITWSWGPDGDVTYQTNWRGEQ
 
Nucleotide Sequence: 489 bp     [Download]
>gi|119943794|ref|NC_008709.1|:28101-28589 Psychromonas ingrahamii 37 chromosome, complete genome
ATGGAATTTTCGGGTTATATGAAAATTGAAGGTGATATTCAGGGCGTTATTGAAGGCTCTTCAATTAGAA
AAAATCGAGAAACGAGTATTGATCTTTTTTCATTTAAACATGAAATTAAATTACCCACTAATGTGCAGTC
AGGTATGGGAAATGGTCCGGTTATTCATCAGCCAATTGTCTTATTAAAAGAGGTTGATAAAAGTACCCCA
AAGCTATATCGCGCATTGGTTGAAAAAGAACGATTAAATACAGTTGAATTCGAATGGTTTCGATATACGG
CGCAAGGTGAAGAGCTTGTTTATTATCGTATTGAATTAATAAATGCGCATATTATATCAATCTCTCCCTG
GACGCCTGCATTAGAAAAAGCGGAGTCAGAATATTTACGTTTTATGGAAAATGTAACACTGGCCTATGAA
GGTATTACTTGGAGTTGGGGGCCGGATGGTGATGTTACTTACCAAACCAATTGGCGGGGTGAGCAATAA
 Primer design