SecReT6
Protein ID: 119943814
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0020
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]28589..28993 [+]
Producthypothetical protein
NoteTssE
UniProt IDA1SQY0
KEGG IDpin:Ping_0020
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.30E-09, Aligned region: 28..112
Protein Sequence: 134 a.a.     [Download]
>gi|119943814|ref|YP_941494.1| unnamed protein product [Psychromonas ingrahamii 37]
MLRLSEKLNLLTVKNESAKQLESLNIATSMRNYLQKILNTRQGSVLIAPDMGMPKIDLSEGIVEQVDKQN
VLNMIKILLEKYDPRIESLHTELKENHNITVILSFQLLVTTRSKHVVTLFGKLQSDSTFELELQ
 
Nucleotide Sequence: 405 bp     [Download]
>gi|119943794|ref|NC_008709.1|:28589-28993 Psychromonas ingrahamii 37 chromosome, complete genome
ATGTTAAGGCTTTCTGAAAAGCTTAACTTGCTGACTGTCAAAAATGAATCAGCTAAACAGCTTGAATCAT
TAAATATTGCCACATCGATGCGCAATTATTTACAAAAAATACTCAATACACGTCAGGGTAGTGTACTTAT
TGCGCCTGATATGGGAATGCCTAAAATTGACCTTAGTGAAGGGATTGTCGAACAAGTTGATAAGCAAAAT
GTGCTTAATATGATCAAAATCTTACTTGAAAAGTATGATCCCAGAATAGAATCGCTACATACCGAATTAA
AAGAAAACCATAATATAACGGTTATTTTGTCATTTCAATTATTGGTGACAACCCGATCAAAACATGTCGT
TACTCTCTTTGGAAAATTACAATCTGATAGTACATTTGAACTGGAATTACAATAA
 Primer design