SecReT6
Protein ID: 119943815
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0021
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]28993..30762 [+]
Producthypothetical protein
NoteTssF
UniProt IDA1SQY1
KEGG IDpin:Ping_0021
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.30E-129, Aligned region: 4..585
Protein Sequence: 589 a.a.     [Download]
>gi|119943815|ref|YP_941495.1| unnamed protein product [Psychromonas ingrahamii 37]
MDLADLYQQELKLLKESSQVFSKEYPAITESLNRDIVDPDVDMILQGVSYLTAQFKKELDDQFPVALQAL
SQVLTPTLMQPIPAVSILSLTPKANLISPLMVKKGTGFDSSPAKLDEEGHERIACRFSSAWEVEVLPVRV
ATLVMQQVEKTINQVQQKVVELNVGFTSEKNDLANYSFDKLRFYINQPASDACIWLQMFAQKLQSIKVTS
SAGVADISVKNLQLTGYGAEHNIFDAGNSSNQHSLLQEYYTVPEKLQFFEINLQQWQQRSGDQFSIVFEF
TSPTWSLPEFKTDHLKLYCTPVINEFEHFAEPMAMNGIQLEFPLTAQQRNLSTEFVLPIVDVLTVESIKR
EREKNNRYQNIIIPSNTNSKTGGFYYFRKHGVHDGDVANWLALEFEAGSRPESREVLRVKVKCCHGELAA
KLPPNEINVPTSSSPELVSFTNLTTSSDYLPAQIISNEAWQVVSDQALSLQNIEKADQLKQLLRHHLPAQ
LKNTAKYKTLAHRIAAINDIKITAKDHFEKGLLVRGVEYSVHINSDHFINQGEIFLFSALLNQLLALQVP
INSFSQLIVTESRTEESQRWAINFGGIAK
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|119943794|ref|NC_008709.1|:28993-30762 Psychromonas ingrahamii 37 chromosome, complete genome
ATGGATTTAGCAGACCTATACCAACAAGAGTTAAAACTTTTAAAAGAATCATCACAGGTTTTTAGTAAAG
AATACCCTGCAATTACAGAAAGTTTAAATAGAGATATAGTTGACCCCGATGTTGATATGATCTTACAGGG
TGTTTCCTATTTAACGGCGCAATTTAAAAAAGAGTTAGACGATCAGTTTCCGGTTGCACTGCAGGCCCTA
TCACAAGTATTAACACCCACCTTAATGCAGCCTATTCCGGCAGTCAGCATTCTATCATTAACGCCTAAAG
CAAATTTAATCTCACCTTTAATGGTTAAAAAAGGGACTGGATTTGATTCTTCTCCTGCAAAACTCGATGA
AGAGGGCCATGAACGGATAGCTTGCCGATTCAGCAGCGCTTGGGAGGTTGAAGTGTTGCCGGTGCGTGTT
GCAACGTTAGTGATGCAGCAGGTTGAAAAAACAATTAACCAGGTACAACAGAAAGTGGTTGAACTCAATG
TGGGGTTTACATCAGAAAAAAATGATCTCGCTAATTATAGCTTTGATAAACTGCGTTTTTATATTAATCA
ACCAGCAAGTGATGCTTGTATTTGGTTACAGATGTTTGCTCAAAAATTGCAGTCAATTAAAGTGACAAGC
TCCGCTGGTGTTGCTGATATTTCAGTAAAAAATTTACAATTAACAGGCTATGGCGCAGAGCATAATATTT
TTGATGCCGGCAATTCATCAAATCAGCATAGTCTTTTGCAGGAGTATTATACTGTTCCTGAAAAATTACA
GTTTTTTGAAATTAACCTGCAGCAGTGGCAGCAGCGTAGTGGTGATCAATTTTCAATTGTTTTTGAATTT
ACCTCTCCTACCTGGAGCCTGCCTGAATTTAAAACCGATCACCTAAAACTATACTGTACACCGGTGATTA
ATGAATTTGAGCACTTTGCTGAGCCAATGGCGATGAATGGTATTCAACTTGAATTTCCATTAACCGCTCA
ACAGCGTAATTTATCGACTGAATTCGTTTTGCCTATTGTTGATGTTCTGACGGTTGAAAGTATCAAGCGA
GAACGGGAAAAAAATAACCGTTATCAGAATATTATAATCCCCAGCAATACGAACAGTAAAACCGGTGGTT
TTTATTATTTTAGAAAGCATGGCGTGCATGACGGGGACGTAGCAAATTGGTTAGCTCTGGAGTTTGAAGC
CGGATCAAGACCTGAAAGTCGAGAAGTGTTACGTGTCAAAGTCAAATGTTGCCATGGTGAGCTTGCTGCT
AAATTGCCTCCTAACGAGATTAATGTGCCAACCAGCAGTAGCCCTGAATTAGTTTCTTTTACTAACCTGA
CAACCAGCAGTGATTATCTGCCGGCGCAGATTATTTCCAATGAAGCTTGGCAGGTGGTATCAGATCAGGC
ATTAAGTTTACAAAATATAGAAAAAGCGGATCAGCTTAAGCAACTTCTGCGTCATCACCTTCCTGCGCAA
CTTAAAAACACCGCAAAATATAAAACCCTGGCGCATCGAATTGCTGCGATTAATGATATTAAAATAACCG
CGAAAGATCATTTTGAAAAGGGATTATTGGTTCGAGGAGTGGAGTATTCAGTTCATATAAACAGTGATCA
TTTTATTAACCAGGGGGAAATATTTTTATTTTCAGCCTTGCTGAATCAGTTATTGGCATTACAAGTGCCC
ATTAATAGTTTCAGTCAATTAATTGTGACTGAATCCCGTACCGAGGAATCTCAACGCTGGGCAATTAATT
TTGGCGGTATCGCTAAATGA
 Primer design