SecReT6
Protein ID: 119943816
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0022
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]30759..31712 [+]
Producthypothetical protein
NoteTssG
UniProt IDA1SQY2
KEGG IDpin:Ping_0022
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.40E-60, Aligned region: 8..302
Protein Sequence: 317 a.a.     [Download]
>gi|119943816|ref|YP_941496.1| unnamed protein product [Psychromonas ingrahamii 37]
MIEQELLRNATQYSFIEVYKLLCELALSNKLNPLHAIRIRPVLGLQHARTQVVSVTKQDQPSLYYLNVNL
PGLYGNGSPLPKFFTEELIQASHKDQNQTRLFLDIIHQRLYQLLYAANTQQSPHYLDQGRKNVYQFMLAM
IGFKEASWLKDFPDQAFILRNINIIRHQKSTVVGLQKLLQNLFKKAQVSIEQCVNRDVSIAEGQKLALNQ
QANQISFSAVLGGKMQDIQSKIIVSISPLSAKEYKQWCLTPEYWDALQNMIKYFIGQPLLVDLQIDVVAD
TKFNLSLVPENEFSLGRNAWLKSSNTKQHITASIKLL
 
Nucleotide Sequence: 954 bp     [Download]
>gi|119943794|ref|NC_008709.1|:30759-31712 Psychromonas ingrahamii 37 chromosome, complete genome
ATGATCGAACAAGAGTTACTCCGCAATGCGACTCAATACAGTTTTATTGAAGTCTATAAGCTCTTATGCG
AACTGGCGTTAAGCAATAAACTTAATCCGCTGCATGCTATACGCATCAGGCCGGTTTTAGGCTTACAACA
TGCGCGTACTCAAGTCGTTTCTGTGACTAAACAGGATCAACCGTCTTTATATTATCTGAACGTTAATCTA
CCTGGCCTTTACGGTAACGGCTCCCCCTTACCCAAGTTTTTTACCGAAGAGTTGATCCAGGCATCGCATA
AAGACCAAAACCAAACCCGACTGTTTTTAGATATTATTCATCAGCGTCTTTATCAACTATTGTATGCGGC
AAACACTCAGCAATCTCCGCATTATCTGGATCAAGGGCGTAAAAACGTTTATCAATTTATGCTTGCCATG
ATTGGGTTTAAAGAGGCATCCTGGTTAAAAGACTTCCCTGATCAAGCCTTTATTTTAAGAAATATTAATA
TTATTCGTCATCAAAAAAGCACCGTTGTTGGGCTGCAAAAGCTGCTGCAGAACCTATTTAAAAAAGCGCA
GGTAAGCATTGAGCAGTGTGTTAACCGGGACGTCAGTATAGCAGAAGGGCAAAAACTGGCGTTAAACCAA
CAGGCGAATCAAATCAGTTTCAGTGCGGTGCTCGGCGGAAAAATGCAGGATATTCAATCTAAAATTATTG
TCTCTATCTCCCCCCTGAGTGCGAAAGAATATAAACAATGGTGCTTAACACCTGAGTATTGGGATGCATT
ACAAAATATGATCAAGTATTTTATTGGCCAACCTTTGTTGGTGGACTTACAGATAGATGTGGTAGCCGAT
ACTAAATTTAACCTAAGCTTAGTACCAGAAAATGAATTTTCTTTAGGCCGCAATGCCTGGTTAAAAAGCA
GTAATACCAAGCAGCATATAACGGCTTCAATAAAACTCCTATAA
 Primer design