SecReT6
Protein ID: 119943817
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0023
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]31751..34876 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA1SQY3
KEGG IDpin:Ping_0023
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 8.90E-52, Aligned region: 28..336
Phage_GPD [PF05954], Evalue: 8.90E-52, Aligned region: 848..894
Phage_base_V [PF04717], Evalue: 7.80E-16, Aligned region: 382..466
T6SS_Vgr [PF13296], Evalue: 0.0014, Aligned region: 481..521
Protein Sequence: 1041 a.a.     [Download]
>gi|119943817|ref|YP_941497.1| unnamed protein product [Psychromonas ingrahamii 37]
MSQYHFKFIYQENGSQNNELTLLKFSGQEGISQLFNFELELKSTDLNLDEDSLLNKSCSIEIYDGKQAKP
IRIIHGLVNKFEDINYLPDCTLYRANIVPRIWQLGLFETNEVYLNETIERTLSAILEEAGFIEGQDFRFE
LNRTYRKWPFRLQYNETHLDYLQRIIEREGIYYYFEQNDNAEVIVFCDNNQALPSIVQPDQSKKIVFQAN
SAINVESKACTVTNIICKRQTLPKKVTLRDFNDETPSLDIRGEYIIDKTGMGEINLYGLNITSPEEGQQL
AEIHANAYLSRQKSYIGEGDAATMVIGHTFKLAKHPRDKFNQLTYLLESIDHEGANLNQYQELDLNTDAV
VNYSNSFTALSTEHPFAPKRQTLAPEINGTLNAVIDAEADSGYAELDEFGRYKVKLPFDRKDRNGGKASH
WVRMMQPYGGANEGMHFPLRNGTRVLLGFIGGDPDRPFISGTINDNGEQKSIVTGENQTNNLIKTASGNK
IELEDKEGKNRIKLQTGDNKTYMHLGSPNHPGDGFVVMSKGIERKEVTGGKQITRVTTNFATTAYLNDDN
TLGSFHNSFDEDTSSVESEDLLDEQNYFLFPIKSLKGDGVAAADAVPEVPAKAARTSPDVAAEAAIPAVA
STFTASSVLSLPADNLMTRNVELSGYYLIERTLGDKYTFEQGNEYEFNSPGDKRFQYGADREIIVCQDDA
SLGKSIKGEVYNKENHLKENQNKNRNLDAGSRLYRSLVELLTLKLTGYQSFTQSPLDGICKRFHKKLTPE
EANDLLDNKCNFRVARHNTFNIQEGNIFDFGGYWNYDLGNSYAEVHGTQETEINKLYSKDIAKKAGPWWE
KIEGKKLSFAQKDEEQVEKSYNNQYSYTKGKTIEVHKGDAESQHYGNSYDYHTGDSYEEVDGHSISHVRG
SCHSTHHGATNEMFMGAKSEFLLGVSSSVVVAAVNDMFVGPKIEIQVAPGFYFSAGSKTEIESFKFKNVA
TEAANAAIDLQAAIATVDNDITILMNSINTIQSSVNTVVTKANEVDFTMIKLSSGAVNMLN
 
Nucleotide Sequence: 3126 bp     [Download]
>gi|119943794|ref|NC_008709.1|:31751-34876 Psychromonas ingrahamii 37 chromosome, complete genome
ATGAGCCAATATCATTTCAAATTCATCTATCAGGAAAATGGTTCGCAAAATAATGAGTTAACATTATTGA
AATTTTCCGGGCAGGAAGGTATCTCCCAATTATTTAATTTTGAATTGGAGCTTAAATCCACCGATCTTAA
TTTAGATGAAGATAGCCTGTTAAACAAATCCTGCAGCATCGAAATTTATGATGGCAAGCAAGCTAAACCT
ATTCGTATTATCCATGGTTTAGTCAATAAATTTGAAGATATTAACTACCTGCCTGACTGCACCTTATACC
GCGCTAATATTGTACCTAGAATCTGGCAGCTCGGATTGTTTGAAACCAATGAAGTATATTTAAACGAAAC
AATTGAGCGAACACTCAGCGCCATATTAGAGGAAGCTGGCTTTATTGAAGGGCAAGACTTCCGTTTTGAA
CTGAACCGCACTTACCGTAAATGGCCCTTCAGGCTGCAATATAACGAAACCCATTTAGATTATCTGCAGC
GCATTATCGAGCGTGAGGGAATTTATTATTATTTCGAACAAAACGATAATGCCGAGGTGATTGTCTTTTG
TGATAATAACCAGGCGTTGCCATCAATCGTCCAGCCCGACCAAAGCAAAAAAATTGTGTTTCAGGCCAAT
AGCGCTATTAATGTCGAAAGCAAGGCTTGCACAGTGACCAATATTATCTGTAAGCGCCAGACGCTGCCAA
AAAAAGTGACATTACGTGATTTTAATGATGAGACCCCCTCCTTAGATATTCGTGGTGAATATATTATTGA
TAAGACTGGTATGGGGGAAATTAACCTCTACGGGCTAAATATAACCTCACCCGAAGAAGGTCAGCAATTG
GCGGAAATACACGCTAATGCCTATTTAAGCCGTCAAAAATCCTATATTGGTGAAGGTGATGCGGCCACTA
TGGTCATAGGTCATACTTTTAAGCTTGCCAAACATCCCAGAGATAAGTTTAACCAGTTAACCTACTTATT
AGAAAGTATTGATCATGAAGGTGCTAATTTAAATCAATATCAGGAATTGGACTTAAATACCGATGCCGTA
GTGAACTACAGCAACAGCTTTACCGCGCTTTCAACTGAGCATCCATTTGCCCCGAAAAGACAAACGCTCG
CCCCTGAAATTAACGGTACGCTGAATGCGGTTATCGATGCTGAAGCGGATTCCGGCTATGCGGAGCTCGA
TGAATTTGGCCGTTACAAAGTCAAACTGCCCTTTGACAGAAAAGATCGCAATGGCGGCAAGGCTTCTCAT
TGGGTACGTATGATGCAGCCCTATGGCGGCGCAAATGAGGGGATGCATTTTCCGCTGCGCAACGGTACGC
GGGTATTATTAGGTTTTATTGGCGGCGATCCGGACAGACCCTTTATTAGCGGCACTATTAATGATAATGG
CGAGCAGAAAAGTATTGTCACCGGTGAAAATCAAACCAATAATCTTATAAAAACTGCCTCGGGCAATAAA
ATAGAGCTGGAAGACAAAGAAGGTAAAAACCGCATTAAACTGCAGACGGGTGATAATAAAACCTATATGC
ATTTAGGCTCGCCCAATCATCCCGGCGATGGCTTTGTCGTGATGTCTAAGGGAATAGAACGTAAAGAGGT
GACGGGAGGTAAGCAAATTACACGTGTTACTACAAACTTTGCGACTACTGCTTACCTTAATGATGATAAT
ACCTTAGGAAGCTTCCATAACAGCTTCGATGAAGATACAAGTTCTGTTGAAAGTGAAGATTTGTTAGATG
AACAAAATTATTTTTTATTTCCAATAAAAAGTCTCAAAGGTGATGGGGTAGCTGCTGCTGATGCTGTTCC
GGAGGTTCCGGCTAAAGCTGCTCGTACTTCTCCTGATGTTGCTGCTGAAGCTGCTATCCCTGCTGTTGCT
AGTACATTTACGGCTTCATCAGTTTTGAGTTTGCCTGCAGATAACTTGATGACAAGAAATGTTGAGTTAT
CTGGTTATTACCTTATAGAAAGAACGCTGGGTGATAAATATACTTTTGAGCAGGGAAATGAATATGAATT
TAATTCGCCGGGGGATAAACGCTTTCAGTATGGTGCGGACAGAGAAATTATAGTGTGTCAAGATGATGCA
AGTTTAGGTAAGAGTATTAAAGGCGAAGTTTATAATAAAGAAAATCACCTCAAAGAAAATCAAAACAAAA
ATCGTAATCTCGATGCAGGAAGCAGGTTATACAGGTCTCTTGTCGAGTTGTTGACCCTTAAACTTACAGG
TTACCAAAGTTTTACTCAATCTCCCCTGGATGGGATCTGTAAGAGATTTCATAAAAAATTAACACCCGAA
GAAGCCAACGACCTGTTAGATAACAAGTGTAATTTCAGAGTAGCCAGACACAATACCTTTAATATTCAGG
AAGGTAATATTTTTGATTTTGGCGGTTATTGGAATTATGACTTGGGCAACAGTTATGCGGAAGTACATGG
TACACAAGAGACTGAAATTAACAAATTATATTCTAAGGATATAGCCAAAAAAGCAGGCCCATGGTGGGAG
AAAATCGAGGGTAAAAAGCTTAGTTTTGCTCAGAAAGATGAAGAACAGGTAGAAAAATCATATAACAACC
AATATAGCTATACTAAGGGCAAGACAATCGAAGTACATAAGGGCGATGCAGAAAGTCAGCATTATGGTAA
TTCTTATGATTATCATACAGGTGATAGTTATGAAGAAGTTGATGGTCATTCTATTTCTCATGTTCGTGGT
AGTTGTCATAGCACACATCATGGAGCGACTAATGAGATGTTTATGGGGGCAAAGAGTGAGTTTCTATTAG
GAGTGTCTAGCTCTGTCGTTGTTGCAGCAGTTAATGATATGTTTGTAGGACCTAAAATTGAAATACAAGT
CGCTCCAGGCTTTTACTTCAGTGCTGGTTCCAAAACGGAAATTGAATCTTTTAAATTTAAAAACGTGGCG
ACAGAAGCCGCAAATGCAGCTATTGATTTACAAGCTGCTATTGCCACAGTAGACAATGATATAACGATAT
TAATGAATAGTATCAACACTATACAAAGCTCAGTAAACACTGTTGTTACTAAAGCTAATGAAGTTGACTT
TACGATGATAAAGTTATCATCGGGCGCAGTGAACATGCTGAATTAA
 Primer design

Protein ID: 119943822
SecReT6 ID162
T6SS typei1
Gene symbol-
Locus tagPing_0028
StrainPsychromonas ingrahamii 37
Repliconchromosome [GenBank: NC_008709] [Browse all T6SS(s) in this replicon]
Location [Strand]40134..43757 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA1SQY8
KEGG IDpin:Ping_0028
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.30E-53, Aligned region: 33..341
Phage_GPD [PF05954], Evalue: 1.30E-53, Aligned region: 810..872
CBM_5_12 [PF02839], Evalue: 2.90E-19, Aligned region: 559..584
CBM_5_12 [PF02839], Evalue: 2.90E-19, Aligned region: 609..634
CBM_5_12 [PF02839], Evalue: 2.90E-19, Aligned region: 655..684
CBM_5_12 [PF02839], Evalue: 2.90E-19, Aligned region: 993..1007
Phage_base_V [PF04717], Evalue: 1.20E-14, Aligned region: 387..473
T6SS_Vgr [PF13296], Evalue: 0.0015, Aligned region: 485..524
Toxin_46 [PF15526], Evalue: 0.0035, Aligned region: 611..634
Toxin_46 [PF15526], Evalue: 0.0035, Aligned region: 641..680
Protein Sequence: 1207 a.a.     [Download]
>gi|119943822|ref|YP_941502.1| unnamed protein product [Psychromonas ingrahamii 37]
MSQYHFKFICQGHDSQDKDSPDSELTLLKFSGQEGISRLFNFTLELKSTDLNLDEDSLLDKPCRIEIYDG
KQAKPIRIIHGLVNEFEDINYLPDCTLYRATIVPRIWQLGLFETNEVYLNETIEQTLSVILEEAGFIENQ
DFRFELARTYRKWPFRLQYNETHLDYLQRIIEREGIYYYFEQSDSAEVIVFCDNNQALPSIAQPDQSSKI
VFQANSGINVASKANTVTNIICKRHTLPKKVTLRDFNDETPSLDIRGEHIINNRGRGEINLYGLNITSPE
EGQQLAEIHANAYLSRQKVYIGESDAATMVIGHTFKLSEHPRDKFNQLTYLLESIDHEGTNLNQYQELHP
ETDLVVNYSNSFTALSTEHDFAPKRQTLAPEINGTLNAVIDAEADSGYAELDAFGRYKVKLPFDRKDRYG
GKASHWVRMMQPYGGANEGMHFPLRNNTRVLLGFIGGDPDRPFISGTINDSGDQQSIVTAENQTNNVIKT
ASGNKIELEDKEGKNRIKLQTGDNQTYMHLGAPNHDGSGYVMVTGGIERRDIGGGQRVDIRTVPETLNAP
AYSSDETYSLGDLVRHSGKFYKCNTAIITIESFAKTKWDFVANVGNSVTAYSNSSTYTVDDIVSHNGKSY
KCTTAIDPAEGFTASKWSVIGSVATYLNTNTYVLNDIVSHNGKSYKCTTAINSGEEFTALKWSGIHLFRA
SVDSASAFISPHDEYSGKYIISRINGEQHNYNVGNRFNYYATASDGTGVFTPNSANKHFFFGNNWEVHHS
AHGSIEIDSLSTIMEQYGLAGVLDYAGNPLPASEQADIDKAQTAADNALTTAQYNRDNPVSSDKIAGLDK
AVTAAKKAATTDAVNATAKWYKYLEKGRVSVAQHDTFTAQNGNIFDFGGYWNYNLGNSYEENTITQGNTE
INRDKLDYDWCDIGGPNWTVLTPPSDAFSKFGNPDLTGFIGSTNMGKNIDGHTYDYSTNTHGIEINHKCN
SFELSVGGESREVKYNGEGKKTYESKSGAGKSEEWSWTPGGEWGTYSKSVFTDEDGKYNESKNFLNYTQT
SYETSSEPAPGAKFSFKADYLPTLEMKMEVDVGETKLSTHIGVMSNEVDIDLTAIRNVIKVEGFLLNTEN
ILALETKFDYGGKYKNFSLVADFNLDTVRLQLEKRAAVIEMAVYELSVKQNAKIALNAGNIAINKKDIEV
NKSSIKINSTDIMHLIF
 
Nucleotide Sequence: 3624 bp     [Download]
>gi|119943794|ref|NC_008709.1|:40134-43757 Psychromonas ingrahamii 37 chromosome, complete genome
ATGAGCCAATATCATTTCAAATTCATCTGTCAGGGCCATGATTCGCAAGACAAGGATTCGCCAGACAGTG
AGCTGACATTATTAAAATTTTCTGGTCAGGAAGGTATCTCCCGGTTATTTAATTTTACATTGGAGCTTAA
ATCCACTGATCTTAATTTAGATGAAGACAGCTTACTGGATAAACCCTGCCGAATAGAAATTTATGATGGC
AAGCAAGCTAAACCTATTCGTATTATTCATGGTTTAGTCAATGAATTTGAAGATATTAACTACCTGCCTG
ACTGCACCTTATACCGCGCGACTATTGTCCCTAGAATCTGGCAGCTCGGATTGTTTGAAACCAATGAAGT
GTATTTAAACGAAACCATTGAGCAGACACTGAGTGTTATATTAGAGGAAGCCGGCTTTATTGAAAATCAA
GATTTTCGCTTTGAACTTGCCCGTACTTACCGTAAATGGCCCTTCAGGCTGCAATACAACGAAACCCATT
TAGATTATCTGCAGCGCATTATTGAGCGTGAGGGAATTTATTATTATTTTGAGCAAAGCGACAGTGCCGA
GGTGATTGTCTTTTGTGATAATAACCAGGCATTGCCGTCAATCGCCCAGCCCGACCAAAGCAGTAAAATT
GTGTTTCAGGCCAATAGCGGTATTAATGTGGCAAGCAAAGCAAACACAGTGACCAATATTATCTGTAAAC
GCCATACGCTGCCGAAAAAAGTGACATTACGTGATTTTAATGACGAAACGCCCTCCTTAGATATTCGTGG
GGAGCATATTATTAATAATCGCGGCAGGGGAGAAATTAACCTTTACGGATTAAATATTACTTCACCCGAA
GAGGGGCAGCAATTGGCGGAAATACATGCCAATGCTTATTTAAGCCGTCAAAAAGTGTATATCGGTGAGA
GTGATGCGGCGACTATGGTGATAGGTCATACTTTTAAGCTTAGCGAGCATCCTCGAGACAAGTTTAACCA
GTTAACCTATTTATTAGAAAGTATTGACCATGAAGGTACTAATTTAAATCAATATCAGGAATTACACCCG
GAAACAGATCTTGTGGTGAATTACAGCAACAGTTTTACCGCGCTTTCAACTGAGCATGACTTTGCCCCGA
AAAGACAAACGCTCGCCCCTGAGATTAACGGTACATTGAATGCGGTTATCGATGCTGAAGCGGATTCCGG
CTATGCGGAGCTCGATGCGTTCGGCCGTTACAAAGTCAAATTGCCCTTTGACCGAAAAGATCGGTATGGC
GGCAAGGCTTCACATTGGGTACGTATGATGCAGCCCTATGGCGGCGCAAATGAAGGCATGCATTTTCCGC
TGCGCAATAATACCCGGGTATTATTGGGCTTTATTGGCGGCGATCCGGATCGACCCTTTATCAGCGGCAC
TATTAATGACAGTGGCGACCAGCAGAGTATTGTCACCGCTGAAAATCAAACCAACAATGTTATAAAAACC
GCCTCTGGTAATAAAATAGAGCTGGAAGATAAAGAGGGAAAAAACCGCATTAAACTGCAGACGGGGGATA
ATCAAACCTATATGCACTTAGGGGCACCCAATCATGATGGTTCGGGGTATGTGATGGTGACAGGGGGGAT
AGAGCGCAGAGATATTGGCGGTGGTCAGAGAGTAGATATTAGAACGGTACCGGAGACCTTAAATGCTCCT
GCATATTCTTCAGACGAAACTTACAGTCTTGGAGATTTAGTTCGTCATAGTGGAAAATTTTATAAATGTA
ACACTGCAATTATTACAATTGAATCGTTTGCTAAGACAAAATGGGATTTTGTAGCGAATGTAGGGAACAG
TGTAACTGCTTATTCGAATAGTAGTACTTATACTGTCGATGATATCGTTAGTCATAACGGTAAATCATAC
AAGTGTACTACCGCAATAGATCCTGCAGAGGGGTTTACCGCTTCAAAGTGGAGTGTGATTGGAAGTGTAG
CTACTTATTTGAATACTAATACTTATGTTCTTAATGATATTGTTAGTCATAACGGTAAATCATACAAGTG
TACTACCGCAATAAATTCGGGAGAGGAGTTTACCGCTTTAAAGTGGAGTGGAATACATTTATTTAGAGCT
TCAGTGGACTCTGCTTCTGCATTCATTAGCCCCCATGATGAATATTCAGGTAAATATATTATTTCACGAA
TCAATGGAGAGCAACATAATTACAATGTAGGTAATAGATTTAATTATTATGCTACGGCTTCCGATGGTAC
AGGTGTTTTTACTCCGAATAGCGCTAATAAACACTTTTTCTTTGGTAATAATTGGGAAGTGCATCATTCG
GCTCACGGTAGTATCGAAATTGATAGTCTTAGTACAATCATGGAGCAATATGGTCTGGCGGGGGTACTTG
ACTATGCAGGAAACCCTTTACCCGCGTCCGAACAAGCTGATATTGATAAGGCTCAAACCGCTGCAGATAA
TGCTCTAACTACAGCTCAATATAATCGAGATAACCCAGTATCTTCAGATAAAATTGCTGGTCTTGATAAG
GCTGTTACTGCGGCTAAAAAAGCCGCAACAACAGATGCTGTTAACGCTACTGCCAAATGGTACAAATATT
TAGAAAAAGGTCGCGTTAGTGTCGCGCAGCACGATACTTTCACTGCGCAAAACGGTAATATTTTCGATTT
TGGTGGTTACTGGAATTATAATTTGGGTAATAGTTATGAGGAAAATACTATCACTCAAGGTAATACAGAA
ATTAATCGTGACAAGTTAGACTATGACTGGTGTGATATTGGAGGACCCAACTGGACGGTATTAACACCAC
CATCTGACGCATTTTCAAAATTTGGTAACCCTGACCTTACTGGTTTCATAGGTAGTACTAATATGGGAAA
AAACATAGATGGTCATACCTATGATTACAGTACGAATACTCATGGTATTGAGATAAACCATAAATGTAAT
TCTTTCGAACTTTCTGTCGGAGGAGAAAGCAGAGAAGTTAAATATAACGGTGAGGGGAAGAAGACCTATG
AGTCTAAGTCCGGCGCAGGAAAATCAGAAGAATGGAGCTGGACACCTGGAGGGGAGTGGGGTACTTATTC
TAAAAGTGTTTTTACCGATGAAGATGGTAAGTATAATGAAAGTAAAAATTTTTTAAATTACACACAAACT
TCTTATGAAACATCTAGCGAACCGGCACCGGGAGCTAAATTTAGTTTTAAAGCGGATTATTTACCAACGC
TAGAAATGAAAATGGAAGTGGACGTAGGCGAAACGAAACTCTCTACACATATAGGTGTCATGTCAAATGA
AGTTGATATAGACCTTACGGCTATCAGAAACGTTATCAAAGTTGAAGGCTTTTTATTAAATACCGAGAAT
ATTTTAGCTCTAGAAACAAAATTCGATTATGGCGGAAAATATAAGAACTTTAGCTTGGTCGCCGATTTTA
ATCTGGATACTGTTAGGCTTCAACTTGAAAAAAGAGCCGCGGTTATTGAGATGGCAGTATATGAATTAAG
TGTAAAACAAAATGCTAAAATTGCACTCAATGCAGGAAATATTGCAATAAATAAAAAGGATATAGAAGTA
AACAAGAGTAGCATAAAAATAAACAGTACAGATATTATGCATCTTATTTTTTAA
 Primer design