SecReT6
Protein ID: 120556624
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3719
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4123522..4125693 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA1U719
KEGG IDmaq:Maqu_3719
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.40E-62, Aligned region: 45..346
Phage_base_V [PF04717], Evalue: 2.30E-25, Aligned region: 386..479
DUF2345 [PF10106], Evalue: 0.0061, Aligned region: 588..630
Protein Sequence: 723 a.a.     [Download]
>gi|120556624|ref|YP_960975.1| Rhs element Vgr protein [Marinobacter aquaeolei VT8]
MAQAENGYIQSSGIEVMPQASGLQFTARVGEFPSDHFVVVGFALTERLSDLFHGRLQLASTDPDVAAADV
LEQPVDLVVWQDGQPLRRFTGVVNEFMRGDTGHRRTRYEVVIQPPLWRLGLMHNSRIFQTQTTDAIVRTL
LEERGIVDSIFDFKRPPEEREYCVQHRETDLQFLERLAAEEGWHYRYQHGSVDGEEQPALILADHHGDAP
KLDPVTCNTKAGGSTQQACVFQFAYEERVKAASVAMKDYTFKNPAYALMHEHSAADANHREDYQHYDYPG
RYKADASGQPFTQNKLDALRNDAAMANGKSNRPDFTPGAKVELQDHDSQTLNREWLLTAITHTGKQPQAL
EEEGGSEPTSYHNTFSAIPADKTWRPLCNHKPVMDGPQMALVTGPDGEEIHCDQYGRVKVRFPWDRYSKN
DEHSSAWLRVAQGWAGGQYGFMALPRIGHEVIVSFLDGDPDQPIITGRTYHATNTPPYALPEHKTRTTLK
TKTHKGEGSNELRFEDEAGEEQIYVHAQKDLDLLTENNRTEVIKNDSHLTVENNRFSHTQGNSHHTVDGE
KRERTGKDHSFNVTGTLHLKAGTAWLSNSGTELHIKAGQKAVIEAGAEITLKAGGSFVKIDPSGVAMGGA
SIKMNAGGAAGKGSGQKVQVPEMPGLVTAAGGSVAPEALAEVSQRASAQPKAIVAHRLKQARMNRTAIVE
QCQQKPDGTCPLGNCPCGKNQTA
 
Nucleotide Sequence: 2172 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4125693-4123522 Marinobacter aquaeolei VT8, complete genome
ATGGCGCAGGCTGAAAACGGATACATTCAATCTTCAGGGATCGAAGTCATGCCCCAGGCAAGCGGATTGC
AGTTCACCGCCCGTGTAGGCGAATTCCCCTCGGACCACTTTGTCGTTGTCGGCTTCGCGCTGACCGAACG
GCTGTCCGATCTGTTCCATGGCCGGTTGCAACTGGCCAGCACCGACCCGGATGTGGCCGCCGCCGATGTA
CTGGAACAGCCGGTAGACCTGGTGGTGTGGCAGGATGGCCAGCCCCTGCGCCGGTTCACCGGCGTGGTGA
ACGAATTTATGCGGGGCGACACCGGCCACCGCCGCACCCGCTACGAAGTCGTCATCCAGCCGCCCCTGTG
GCGCCTGGGCCTGATGCACAACAGTCGCATCTTCCAGACCCAGACCACCGACGCCATCGTGCGCACCCTG
CTCGAAGAGCGGGGCATTGTGGATTCCATCTTCGACTTCAAACGCCCACCGGAAGAACGGGAATACTGCG
TCCAGCACCGGGAAACCGACCTGCAGTTCCTGGAACGCCTGGCCGCCGAAGAAGGCTGGCACTACCGCTA
CCAGCACGGCAGCGTGGATGGCGAAGAACAACCGGCACTGATTCTTGCCGACCACCACGGCGACGCCCCG
AAACTGGACCCGGTCACCTGTAACACCAAAGCCGGTGGCAGCACCCAACAGGCCTGCGTGTTCCAGTTTG
CCTACGAAGAACGGGTGAAAGCCGCCTCCGTGGCCATGAAGGACTACACCTTCAAGAACCCCGCCTACGC
CCTGATGCATGAACACAGCGCTGCCGACGCGAACCACCGGGAAGACTACCAGCACTACGACTACCCCGGC
CGCTACAAAGCCGACGCCAGCGGCCAGCCGTTCACCCAGAACAAACTGGATGCCCTTAGAAACGACGCCG
CCATGGCCAACGGCAAAAGCAACCGCCCGGACTTCACCCCCGGCGCCAAAGTGGAACTGCAGGACCACGA
CAGCCAGACCCTGAACCGGGAATGGCTGCTCACCGCCATCACCCATACCGGCAAACAGCCCCAGGCCCTG
GAAGAAGAGGGTGGCAGCGAACCCACCAGCTACCACAACACCTTCAGCGCCATTCCGGCCGACAAAACCT
GGCGCCCGCTGTGCAACCACAAACCCGTGATGGACGGCCCCCAGATGGCCCTGGTCACCGGCCCTGACGG
AGAAGAAATTCACTGCGACCAGTATGGCCGGGTGAAAGTACGATTCCCTTGGGACCGCTATTCCAAGAAC
GACGAACACTCAAGCGCCTGGCTGCGCGTGGCCCAGGGCTGGGCCGGTGGCCAATACGGCTTCATGGCCT
TGCCCAGAATTGGCCACGAGGTCATCGTCAGCTTCCTGGATGGCGACCCGGACCAGCCCATCATCACTGG
AAGAACCTATCACGCCACCAATACACCGCCGTACGCGCTGCCGGAACACAAAACCCGGACCACCCTGAAG
ACCAAAACCCACAAGGGCGAGGGCAGCAACGAACTGCGCTTTGAAGACGAAGCGGGCGAAGAGCAGATCT
ACGTGCACGCCCAGAAAGACCTGGACCTGCTGACGGAAAACAACCGCACCGAAGTTATCAAGAACGACAG
CCATCTGACGGTGGAAAACAACCGCTTCAGCCACACCCAAGGCAACAGCCACCACACCGTGGACGGCGAA
AAGCGCGAACGAACCGGCAAAGACCACAGCTTCAATGTCACCGGTACTCTGCACCTGAAAGCCGGCACCG
CCTGGCTCAGCAATTCCGGCACCGAACTGCATATCAAAGCCGGCCAGAAAGCCGTGATCGAAGCCGGCGC
TGAGATCACCCTGAAAGCCGGCGGCAGCTTCGTGAAGATCGATCCCAGCGGCGTGGCCATGGGGGGCGCG
AGTATCAAGATGAATGCCGGTGGGGCTGCAGGTAAAGGCAGTGGGCAGAAGGTGCAGGTGCCGGAGATGC
CGGGGTTGGTGACGGCTGCTGGCGGGTCAGTGGCGCCGGAGGCGTTGGCGGAGGTTAGCCAGAGAGCGAG
TGCTCAGCCAAAAGCCATCGTTGCCCATCGACTAAAACAGGCTCGGATGAATCGAACGGCCATTGTTGAG
CAGTGCCAGCAGAAACCCGATGGCACTTGTCCGCTTGGGAACTGTCCTTGCGGTAAGAATCAGACAGCGT
GA
 Primer design