SecReT6
Protein ID: 120556625
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3720
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4125749..4129333 [-]
ProductFis family transcriptional regulator
NoteTssM
UniProt IDA1U720
KEGG IDmaq:Maqu_3720
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.70E-97, Aligned region: 509..837
ImcF-related_N [PF14331], Evalue: 1.30E-80, Aligned region: 199..459
DUF1215 [PF06744], Evalue: 2.50E-34, Aligned region: 931..1052
Protein Sequence: 1194 a.a.     [Download]
>gi|120556625|ref|YP_960976.1| Fis family transcriptional regulator [Marinobacter aquaeolei VT8]
MWRKALLIGRWLLPYIRSAAPVTLALGVIALLVATWWLGPRLEINGDYPLMAWQMRALVTLGVVLMVVMV
WGTMLARRLGKVNKAKAEEQREQEDPILPMERRQQRLLDRQLQALKSNLPGRKGLYRLPWYLVMGLEDAG
KTSLIQRAGQTYTLTNVTRNNRGDRNPFSFDWWIGDNGVLIDPDGELLSQNQGEGATGEIQSRLWNHFIA
WLERSRPQRPLNGVILAVDLARLSAANEQQREAHAILLRTRLRELMEQLGSRLPVYVTFTKMDLMYGFAP
FVRTLSKAEKDKALGFTFRLDGQQDQDQWLEQFAERYADMVDELTERLPDVLANTRDNEERAAAYSFTRQ
LAGLKPAMEQFLTDLLSADAFSTPALVRGTYFTSVLQEGVPEDAFVSAAARNYQMSDPIQPAQRGGQSAS
LFTKGLFPEIIYPEAGLAGDNRRVVRQRHRRVAVAAVVALAAGAGMTAGWQHYFLQNAEAAAQVENRVKS
YLNDWQPVGYEPDTTGRNLLQPLDELRDATLAFGDYRKEWPLVTDMGLYQGHKVGPEVDKAYLNMLAYQY
LPALMFGVMEEMGQAPDNSTERLEHLRVLRMLYDASGRRTDIVSGYMREYWQARFPGQRDVQNRLYGHLQ
YAMAHTDLSDLAANGDPTATMALAPFRSSVEWAQHELGRISTSDRVYRELENEASRDFPTPLELARSSGP
AFSTVFTRLDSYGEPLAEDVPSAEDPLSIPALLTREGLEKWFLRESGSVTELALIDAWVLGRRDDVDFSK
ADEAELLASLQTLYAEHYAEAWRTALSRLDIHRFEDLNHGVRILDSLTSGHQPLARLLAQVRENTRLIPV
GEGEAEAARKLLEQSPHYRMLQDIERQFSDLNQLTRKQGEEQSGLEEVMLVVAELHEYMRNIQESPDTGK
AALSAARARMGLQGADPIFTLQRMAGHQPEPLNRILNRLATESWRVVLDSAVAQLERDWYREVYQPFQQN
LARHYPFTQGAGRDAALQDFERFFAPDGILETFYNDNLKLFLEDHPEHVGDARRASLVRRDVVAALDRAR
QIRQAFFTRSGTLDVEFALEPLNLSNNKRRSVVNIDGQLVEFSHGPSQSIPLVWPNTLRDTVESRVTLVP
IQVNRSPRSISESGPWALFRLLGKADITGVSSNAVDVKFTVDDGEMRYRLHAASNTNPFTEQLLSGYRIP
RSLY
 
Nucleotide Sequence: 3585 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4129333-4125749 Marinobacter aquaeolei VT8, complete genome
ATGTGGAGAAAAGCATTACTCATTGGTCGTTGGCTTCTGCCCTACATCCGCAGCGCCGCCCCCGTCACCC
TGGCTCTGGGGGTGATCGCCCTGCTGGTAGCCACCTGGTGGCTGGGGCCACGCCTGGAAATCAACGGCGA
CTACCCGTTGATGGCCTGGCAGATGCGTGCTCTGGTCACCCTCGGTGTGGTCCTGATGGTGGTGATGGTC
TGGGGCACCATGCTGGCCCGTCGCCTGGGCAAAGTGAACAAGGCCAAGGCCGAGGAGCAGCGGGAGCAGG
AAGACCCGATTCTGCCCATGGAGCGTCGCCAACAGCGGCTGCTGGACCGCCAGCTGCAGGCGTTGAAAAG
CAATCTGCCGGGTCGCAAGGGCCTGTACCGTCTGCCCTGGTATCTGGTGATGGGCCTGGAAGATGCCGGT
AAGACCAGCCTGATTCAGCGTGCCGGGCAAACCTATACCCTGACCAACGTCACCCGTAACAACCGTGGCG
ACCGTAACCCGTTCAGTTTTGACTGGTGGATTGGCGACAACGGTGTCCTGATCGACCCGGATGGCGAACT
GCTGAGCCAGAACCAGGGTGAGGGCGCCACCGGCGAAATCCAGAGCCGGCTGTGGAACCACTTTATCGCC
TGGCTGGAACGCAGCCGGCCCCAGCGGCCGCTCAATGGCGTTATCCTGGCTGTGGATCTTGCGCGCCTGA
GCGCCGCCAACGAACAGCAGCGTGAAGCCCACGCCATTCTGCTGCGCACCCGCCTGCGGGAGCTGATGGA
ACAGCTTGGGTCACGGCTGCCGGTGTATGTGACCTTCACCAAGATGGATCTGATGTACGGATTTGCGCCG
TTTGTCCGTACTCTCAGCAAGGCGGAGAAGGACAAGGCCCTGGGGTTCACCTTCAGGCTGGACGGCCAGC
AGGATCAGGACCAGTGGCTGGAACAGTTTGCCGAGCGTTACGCCGATATGGTGGATGAGCTCACCGAACG
CCTGCCGGACGTGCTGGCCAACACCCGTGATAACGAAGAACGGGCGGCGGCTTATTCGTTCACCCGCCAG
TTGGCGGGCCTGAAGCCGGCCATGGAGCAGTTCCTGACGGATTTGCTGTCAGCGGATGCCTTCTCCACGC
CGGCACTGGTACGCGGCACCTACTTCACCTCGGTGTTGCAGGAAGGTGTGCCCGAGGACGCCTTTGTCTC
CGCTGCTGCCCGGAACTACCAGATGTCGGACCCGATTCAGCCGGCCCAGCGTGGTGGCCAGTCTGCAAGT
CTGTTCACCAAGGGGCTGTTCCCCGAAATCATCTATCCGGAGGCGGGCCTGGCCGGGGATAACCGGCGGG
TGGTGCGCCAGCGTCATCGTCGGGTGGCCGTTGCCGCCGTGGTGGCCCTGGCCGCCGGTGCGGGCATGAC
GGCGGGCTGGCAGCATTATTTTCTCCAGAATGCCGAAGCGGCTGCCCAGGTGGAAAACCGGGTGAAAAGC
TATCTGAACGACTGGCAGCCGGTTGGCTACGAGCCGGACACCACCGGCCGTAATCTGCTGCAACCGCTGG
ATGAGCTGCGGGATGCCACGCTGGCCTTCGGCGATTACCGCAAGGAGTGGCCGCTGGTGACAGACATGGG
GCTGTACCAGGGGCACAAGGTGGGCCCGGAAGTGGATAAGGCCTACCTGAACATGTTGGCCTATCAATAC
CTGCCTGCGCTGATGTTTGGCGTGATGGAGGAAATGGGCCAGGCCCCGGATAACAGCACTGAGCGGCTCG
AACACCTGCGCGTGCTGCGGATGCTTTACGATGCCAGCGGCCGCCGTACCGACATCGTGTCCGGTTACAT
GCGTGAATACTGGCAGGCCCGTTTCCCCGGCCAGCGTGATGTACAGAATCGCCTGTATGGGCACCTGCAA
TACGCCATGGCCCACACCGACCTGTCGGACCTGGCTGCCAACGGCGACCCAACCGCCACTATGGCTCTGG
CGCCCTTCCGCAGCAGTGTTGAATGGGCACAGCACGAACTTGGTCGTATCAGCACCTCAGACCGCGTATA
CCGCGAGCTGGAGAACGAGGCCAGCCGTGATTTCCCGACCCCTCTGGAACTGGCCCGCAGCTCCGGCCCG
GCGTTCTCGACCGTGTTCACTCGCCTGGACAGTTACGGCGAGCCGCTTGCCGAGGATGTGCCGTCTGCTG
AGGATCCACTCTCGATCCCGGCGTTGTTGACCCGGGAGGGCCTTGAAAAATGGTTCCTGCGGGAATCCGG
ATCGGTCACTGAACTGGCCTTGATTGACGCCTGGGTGCTGGGCCGAAGGGATGATGTCGATTTCAGCAAG
GCCGATGAAGCCGAACTGCTGGCCAGCCTGCAAACGCTGTACGCCGAGCACTATGCCGAGGCCTGGCGCA
CAGCGCTGAGCCGGCTGGATATCCATCGGTTTGAGGATCTCAACCACGGCGTTCGTATTCTCGACAGCCT
GACCAGCGGCCATCAGCCACTGGCCCGATTGCTGGCGCAGGTGCGGGAAAACACTCGCCTGATTCCGGTA
GGTGAAGGCGAAGCGGAAGCCGCACGCAAGTTGCTTGAGCAATCTCCCCATTACCGCATGCTGCAGGACA
TAGAGCGCCAGTTCAGCGATCTGAACCAGCTGACCCGCAAGCAGGGTGAGGAGCAGTCTGGGCTGGAGGA
AGTCATGCTGGTGGTGGCGGAGCTGCATGAATACATGCGAAACATCCAGGAATCCCCGGATACCGGCAAA
GCCGCCCTCAGTGCCGCTCGTGCCCGCATGGGCCTGCAGGGCGCCGACCCTATCTTCACCCTGCAGCGCA
TGGCCGGCCATCAGCCGGAACCCCTGAACCGGATACTGAACCGCCTGGCCACCGAAAGCTGGCGGGTGGT
TCTGGACAGTGCGGTGGCCCAGTTGGAGCGTGACTGGTATCGCGAGGTTTACCAGCCTTTCCAGCAGAAC
CTGGCCCGGCATTATCCGTTTACCCAGGGGGCAGGGCGTGATGCCGCGCTGCAGGACTTCGAGCGCTTCT
TCGCGCCGGACGGTATTCTGGAGACTTTCTACAACGACAACCTGAAGCTGTTCCTGGAAGACCATCCGGA
ACATGTGGGTGATGCCCGCCGGGCCAGCCTGGTGCGCCGGGACGTGGTTGCTGCGCTGGACCGTGCCCGG
CAGATTCGCCAGGCGTTCTTTACCCGCAGCGGTACGCTGGATGTGGAATTCGCGCTGGAACCCCTGAACC
TCAGCAACAACAAACGTCGCTCGGTGGTGAATATCGATGGCCAGCTGGTGGAGTTCTCCCATGGCCCCAG
CCAGAGCATTCCGCTGGTATGGCCGAACACCTTGCGGGACACCGTGGAGAGCCGGGTAACGCTGGTGCCG
ATTCAGGTAAACCGCTCGCCCCGGAGCATTTCCGAGAGCGGTCCCTGGGCACTGTTCCGGTTGTTGGGTA
AGGCGGACATCACCGGTGTCAGCAGCAATGCGGTGGACGTGAAGTTCACGGTGGATGACGGGGAAATGCG
TTATCGCCTGCACGCGGCCAGCAATACCAACCCGTTCACAGAGCAATTGCTCTCAGGGTACCGCATACCC
CGCAGCTTGTATTAA
 Primer design