SecReT6
Protein ID: 120556626
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3721
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4129370..4130818 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA1U721
KEGG IDmaq:Maqu_3721
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.00E-17, Aligned region: 52..112
Protein Sequence: 482 a.a.     [Download]
>gi|120556626|ref|YP_960977.1| ImpA domain-containing protein [Marinobacter aquaeolei VT8]
MQVIEQHPYVDQVLNPIPGDTGVGESLAEDSTLEFLEDEIMKVGSLAHNDIDWHKVESEALKLLADRSKD
IKVLGFVMLSLQRGGDGERFALSLYLLHRVLDDWWENAWPYPGAKGQRARKMLFTQMLQRALKAVESLNF
DASVGDGRQFCLDLVEKLDTQAKDRDLPDDALFDLKRAVEKLPKPDQATAPRTASENTPTNKRETTASSS
PSSSASSNTTAASLGNLTLDPSNERATRQSLLKVAELLTGSEPDNALGYRMRRYAIWQSITSLPPTRDGK
RTDLAAVSADRVAEYKEALEKTPDLELWQRIEQSLSVSPFWLDGHWLSARAAMALGNTDCAEAIREALKA
FVDRLPQLAELTFNDGTPFLSDDGADWLHTAPAAGKGTGAGANPWEQAFDGALELVRQNKLAPAMELLEQ
GLADAREPRERFYWRLATARLLKETGLKALAAEQIQDLKNQIQGRVLDDWEPALIKQLERLA
 
Nucleotide Sequence: 1449 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4130818-4129370 Marinobacter aquaeolei VT8, complete genome
ATGCAGGTGATTGAACAGCATCCGTACGTGGATCAGGTACTGAACCCGATCCCGGGTGACACCGGGGTAG
GCGAAAGCCTGGCTGAAGACAGCACGCTGGAGTTTCTCGAAGACGAGATCATGAAAGTGGGCTCGCTGGC
CCACAACGACATCGACTGGCACAAGGTTGAAAGCGAAGCACTGAAACTGCTGGCGGATCGCAGCAAGGAC
ATCAAGGTTCTGGGTTTTGTCATGCTCAGCCTGCAACGTGGCGGCGATGGTGAACGGTTTGCCCTGTCGC
TGTACCTGCTGCATCGGGTGCTGGACGACTGGTGGGAAAACGCGTGGCCCTATCCCGGTGCCAAGGGGCA
GCGGGCTCGCAAGATGCTGTTTACGCAGATGCTGCAGCGGGCCCTTAAAGCGGTTGAGAGCCTGAACTTT
GATGCCAGCGTAGGAGATGGTCGTCAGTTCTGTCTGGATCTGGTTGAGAAACTGGATACCCAGGCCAAAG
ACCGGGATTTACCTGACGACGCCCTGTTCGACCTGAAGCGGGCCGTGGAAAAGCTGCCCAAGCCGGACCA
GGCCACCGCGCCCCGGACGGCGTCTGAAAACACCCCGACAAACAAACGGGAGACCACGGCCAGCTCATCG
CCCTCCAGCTCGGCCAGTTCCAACACTACGGCCGCGTCGCTGGGCAACCTGACACTGGACCCGAGTAATG
AGCGTGCGACCCGACAGAGTCTGCTCAAGGTCGCCGAACTGCTGACCGGCAGCGAACCGGACAACGCCCT
GGGCTACCGGATGCGTCGGTATGCCATCTGGCAGAGTATCACCAGCCTGCCGCCAACCCGGGATGGCAAG
CGCACAGATCTGGCAGCCGTCAGCGCCGACCGGGTGGCCGAGTACAAGGAAGCTCTGGAGAAAACACCGG
ACCTGGAACTGTGGCAGCGCATTGAACAAAGCCTGTCGGTCAGCCCGTTCTGGCTCGATGGCCACTGGCT
CAGCGCCCGGGCGGCCATGGCCCTTGGCAATACCGATTGCGCGGAGGCCATCCGGGAAGCCCTGAAAGCG
TTTGTCGACCGCCTGCCGCAACTGGCCGAGCTCACCTTCAACGATGGCACACCGTTTCTCAGTGACGATG
GCGCAGATTGGTTGCACACAGCCCCGGCGGCTGGCAAAGGAACGGGCGCAGGTGCCAATCCCTGGGAGCA
GGCATTCGACGGTGCGCTTGAGCTGGTGCGGCAGAACAAACTGGCGCCGGCCATGGAACTGCTGGAACAG
GGTCTGGCCGATGCCCGGGAGCCGCGCGAGCGCTTCTACTGGCGCCTGGCTACGGCCCGGCTGCTCAAGG
AAACCGGCCTGAAAGCCCTGGCCGCCGAACAGATTCAGGATCTGAAAAACCAGATCCAGGGGCGGGTTCT
CGATGACTGGGAACCGGCTCTTATAAAACAACTGGAACGACTGGCGTAA
 Primer design