SecReT6
Protein ID: 120556630
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3725
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4135857..4136678 [-]
Producthypothetical protein
NoteTssL
UniProt IDA1U725
KEGG IDmaq:Maqu_3725
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.80E-72, Aligned region: 51..257
Protein Sequence: 273 a.a.     [Download]
>gi|120556630|ref|YP_960981.1| hypothetical protein Maqu_3725 [Marinobacter aquaeolei VT8]
MADAPVMDRPDNTRDSGDRAFSDLLFADSGAGQSPVESDDSSFQLRGLEENRLIDAATPLLGLVIRVRRL
ADFREVETLYRQVVDEVAAVDRELVEQGYERPTVVAYRYVLCAFIDEAVLGTDWGAHSVWSQHSLLSRFH
NETWGGEKVFAILARMEKEPTRYRDMLEFIYLCLCLGFEGRYKVMENGRDEYEQVVRGLYDQLRELRGDR
DSRPLADATENLMPARNRLRSGLPLWGIGGLFVAAMAGIYSLYNMALNERIRDVLSVLEQLPK
 
Nucleotide Sequence: 822 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4136678-4135857 Marinobacter aquaeolei VT8, complete genome
ATGGCAGATGCACCGGTAATGGACAGACCAGACAACACCAGGGATTCGGGTGATCGTGCATTCAGCGACC
TTTTGTTTGCCGATAGCGGCGCCGGCCAGTCGCCGGTTGAATCCGATGACAGCAGCTTCCAGCTTCGTGG
CCTGGAAGAAAACCGGCTGATTGACGCCGCCACCCCGCTGCTGGGACTGGTTATTCGGGTGCGGCGACTG
GCGGATTTCCGCGAGGTGGAAACCCTGTACCGGCAGGTAGTGGACGAAGTCGCCGCCGTTGACCGGGAAC
TGGTGGAGCAGGGCTATGAGCGCCCCACGGTGGTGGCCTACCGCTACGTGCTTTGCGCCTTCATCGACGA
GGCCGTGCTGGGCACTGACTGGGGCGCCCACAGCGTCTGGTCACAGCATTCGCTACTCAGCCGATTCCAT
AACGAAACCTGGGGTGGCGAAAAGGTGTTTGCCATCCTGGCCCGCATGGAAAAAGAGCCGACTCGTTACC
GGGACATGCTCGAGTTCATCTATCTGTGCCTGTGTCTGGGTTTTGAGGGTCGCTACAAGGTCATGGAAAA
CGGTCGGGACGAATACGAACAGGTGGTTCGTGGCCTCTATGACCAGCTTCGGGAACTGCGTGGCGACCGC
GACAGCCGGCCGCTGGCCGATGCCACGGAAAACCTGATGCCGGCCCGCAACCGCCTGCGCAGCGGCCTGC
CCTTGTGGGGTATTGGTGGTCTGTTTGTGGCGGCCATGGCCGGGATCTATTCGCTCTATAACATGGCGCT
GAACGAACGCATCAGGGATGTGCTCAGCGTTCTGGAACAACTACCGAAATAA
 Primer design