SecReT6
Protein ID: 120556631
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3726
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4136682..4138016 [-]
Producthypothetical protein
NoteTssK
UniProt IDA1U726
KEGG IDmaq:Maqu_3726
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.80E-165, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|120556631|ref|YP_960982.1| hypothetical protein Maqu_3726 [Marinobacter aquaeolei VT8]
MAVTNRVVWSDGLFIKPQHFQQQQRYLEHQINERALAVSDYLFGFSDLELNAEYLSFGRVGLVRASGLFP
DGTRFNLPQDDVMPEPLEITDASVANQVVYLALPLGSDSLAEVEWPEAPVAGRFQAQPVEVRDLHSIDGD
AHTIDVGRVAPRLMLEREDRSAYAALAIGRILEKRPDGSLVMDPNFLPTMLSVRSAPRLQRFVGEMAGLM
QERARNIAERVGAPGQGGVADVSDFMLLQMLNRAHPRFMHLARLRQLHPERLYEALLELCGELVTFTDES
RLPREFTPYDHDLPEGCFSPLMQILRQALSTVLEPRALSITLQQRQYGLTVAPVQDGQLMSDAEFILAVK
ADMPLDDLRKQFVQQCKVASVEKIRDLISLQLPGIPLSALPVAPRQLPYHAGFVYFRLDDQSQAWQMLDN
ASGFAFHVAGSFPGLEMQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4138016-4136682 Marinobacter aquaeolei VT8, complete genome
ATGGCAGTCACGAATCGAGTGGTCTGGAGTGATGGGCTGTTCATCAAACCCCAGCACTTCCAGCAACAGC
AACGCTATCTGGAACACCAGATTAATGAACGGGCGCTGGCCGTCTCGGACTACCTGTTCGGGTTCAGTGA
TCTGGAGCTCAATGCCGAATACCTGAGTTTTGGCCGGGTCGGACTGGTGCGGGCCTCCGGACTGTTTCCG
GACGGAACCCGGTTCAATCTGCCCCAGGACGACGTGATGCCGGAGCCGCTGGAGATCACCGATGCCTCGG
TGGCCAACCAGGTGGTCTATCTGGCTTTACCTCTGGGCAGCGATAGCCTGGCCGAAGTCGAATGGCCGGA
AGCGCCCGTGGCCGGCCGGTTCCAGGCGCAGCCGGTGGAAGTGCGGGATCTGCATTCCATTGACGGCGAT
GCTCACACTATCGATGTGGGGCGGGTGGCTCCGCGCCTGATGCTGGAGCGGGAAGACCGCAGTGCCTATG
CAGCACTGGCCATTGGCCGGATTCTGGAAAAGCGCCCCGATGGCAGCCTGGTAATGGACCCGAACTTCCT
GCCGACCATGCTCAGCGTGCGCTCGGCGCCAAGGCTTCAGCGCTTTGTCGGTGAGATGGCGGGTTTGATG
CAGGAACGGGCCCGCAACATTGCCGAACGGGTGGGCGCGCCCGGGCAGGGTGGTGTCGCCGATGTCTCGG
ATTTCATGCTGCTGCAGATGCTGAACCGGGCGCACCCGCGTTTCATGCACCTGGCACGGCTGCGTCAGCT
GCACCCGGAGCGTCTGTACGAAGCGCTTCTGGAGCTGTGTGGCGAGCTGGTCACCTTTACCGATGAGAGC
CGTTTGCCGAGGGAATTCACCCCTTACGACCATGATCTGCCGGAAGGCTGTTTCAGCCCGCTGATGCAGA
TTCTGCGGCAGGCCTTGAGCACGGTCCTGGAACCCCGGGCGCTGTCGATTACCCTGCAGCAGCGCCAGTA
CGGACTCACCGTCGCACCGGTTCAGGATGGCCAGTTGATGAGCGATGCCGAGTTCATTCTGGCGGTTAAA
GCCGATATGCCACTGGACGACCTGCGCAAACAGTTTGTTCAACAGTGCAAGGTGGCCTCTGTGGAGAAGA
TTCGGGATCTCATCAGCCTCCAGCTGCCGGGCATCCCACTGTCGGCACTTCCGGTGGCCCCGCGTCAGTT
GCCCTACCACGCCGGCTTTGTGTATTTCCGATTGGACGATCAAAGCCAGGCCTGGCAGATGCTGGACAAC
GCCAGTGGATTTGCCTTCCACGTGGCGGGCAGCTTCCCGGGGCTGGAGATGCAATTCTGGGCAATCAGGA
GCTAA
 Primer design