SecReT6
Protein ID: 120556632
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3727
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4138016..4138549 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA1U727
KEGG IDmaq:Maqu_3727
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-35, Aligned region: 12..169
Protein Sequence: 177 a.a.     [Download]
>gi|120556632|ref|YP_960983.1| hypothetical protein Maqu_3727 [Marinobacter aquaeolei VT8]
MKYCKWSLLVVALILAGCSTPYNAVTKTAKVLWDPDIPVGYPEDLPSRVDLTMLAEPNVNPNESLAPTPI
AFQVIELRDSSLLMAGDFDQLLNDLEDSLGQNYVDHSDYSLVPGQFKFVEPFEVSTDTRYIAVIAFYAYP
NLSQWKKVVKVDPIGGRYHLLVNLREREVQLRRSDES
 
Nucleotide Sequence: 534 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4138549-4138016 Marinobacter aquaeolei VT8, complete genome
GTGAAGTACTGCAAATGGAGCTTGCTGGTTGTTGCTTTGATTCTGGCGGGGTGTAGCACCCCTTACAACG
CGGTGACCAAGACCGCCAAGGTGCTCTGGGATCCTGATATTCCTGTTGGCTACCCGGAAGATCTGCCCAG
CCGGGTGGATCTCACCATGCTGGCGGAACCGAACGTGAACCCGAATGAATCCCTGGCACCCACCCCCATT
GCGTTTCAGGTGATTGAATTGCGGGACAGCTCGCTGCTGATGGCGGGCGATTTCGACCAGCTGTTGAACG
ACCTGGAGGACTCTCTGGGCCAGAACTACGTGGACCATAGCGATTACAGCCTCGTGCCCGGCCAGTTCAA
ATTTGTCGAGCCCTTTGAGGTCAGCACCGACACCCGCTACATCGCCGTGATCGCCTTCTACGCCTACCCG
AACCTGTCCCAGTGGAAAAAAGTGGTGAAGGTCGACCCGATTGGCGGACGGTATCACCTGCTGGTGAACC
TGCGCGAACGTGAAGTGCAACTCAGACGGTCGGATGAAAGCTAA
 Primer design