SecReT6
Protein ID: 120556633
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3728
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4138546..4139856 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDA1U728
KEGG IDmaq:Maqu_3728
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.20E-06, Aligned region: 35..101
FHA [PF00498], Evalue: 1.20E-06, Aligned region: 236..243
Protein Sequence: 436 a.a.     [Download]
>gi|120556633|ref|YP_960984.1| FHA domain-containing protein [Marinobacter aquaeolei VT8]
MAQQAAELTLVITNPTETGGGASIEHSFGTRGGSIGTAASDSWQLSPHRTGAVAGHAEVRYLDGGFCLID
RSGRTYINSSSQPVGRGRRARLSHGDTVTIGSYQIRAELSGVPAAVGETEHDAREDHGLVDAPENGLRHA
ANEQSRPEGREPLEGLQPAAGDPVSCDPLAPWQQKPTRPDEEAPELLASDQAWFARSAEVSDEYRENRDV
AMGLPVTPQREHKERQGMSETTRNMREVSRQHISGAPLLRGLDADIDFADSDEMRLFLEEAGQTLKATVE
GLLALHQGEDSRHQALRTRLQPIEDNPLRLANDYPDTIQTLFAAQRSPVHLSAPAAVRESLESLNHHQQA
TREAIREALEAILHAFSPEALLRRFHGYRRGLQENEDEGRWAWDMYQHYYRELKSSRQQGFERLFQEVFD
QAYDQHLRQLQREKLL
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4139856-4138546 Marinobacter aquaeolei VT8, complete genome
GTGGCACAACAAGCAGCAGAACTGACATTAGTGATCACCAACCCGACGGAAACCGGTGGTGGCGCCAGCA
TTGAACATAGCTTCGGAACCCGTGGCGGTTCCATCGGCACCGCGGCCAGCGACAGCTGGCAGCTTTCGCC
TCACCGTACCGGCGCTGTCGCCGGCCATGCCGAGGTGCGTTACCTGGACGGTGGCTTCTGCCTGATTGAT
CGCAGTGGCCGGACCTACATCAACAGCAGCAGTCAGCCTGTGGGGCGGGGCCGTCGTGCCCGACTGAGCC
ACGGCGACACCGTGACCATAGGCAGCTACCAGATACGGGCCGAACTCTCCGGCGTCCCGGCGGCTGTCGG
TGAAACCGAACACGACGCACGCGAAGATCATGGTCTGGTGGATGCACCCGAGAATGGTTTGCGGCATGCC
GCCAACGAACAGAGCCGGCCTGAAGGTCGCGAGCCTCTGGAGGGTTTGCAGCCGGCAGCCGGCGATCCGG
TCAGCTGTGATCCGCTGGCGCCCTGGCAGCAAAAACCGACGCGCCCGGACGAGGAGGCTCCCGAGCTGCT
GGCCAGCGACCAGGCCTGGTTTGCCCGTTCGGCTGAGGTTAGCGATGAGTACCGGGAGAACCGGGATGTG
GCCATGGGCCTGCCGGTCACCCCACAACGCGAGCATAAGGAACGACAGGGAATGTCCGAAACGACACGAA
ACATGCGGGAGGTCAGCCGCCAGCACATCAGTGGTGCACCACTGCTCCGGGGGCTGGATGCGGATATTGA
TTTTGCCGACAGCGACGAAATGCGGCTGTTTCTGGAGGAAGCCGGCCAGACCCTGAAGGCAACGGTGGAA
GGATTGCTGGCGCTGCATCAGGGCGAAGACAGCCGTCACCAGGCGCTGCGCACCCGCTTGCAGCCCATCG
AGGACAACCCGCTGCGGCTGGCCAACGACTATCCGGACACCATTCAGACCCTGTTTGCAGCCCAGCGCAG
CCCGGTGCATCTGTCGGCCCCCGCCGCTGTCCGTGAGAGTCTGGAAAGCCTGAATCACCACCAGCAGGCC
ACCCGGGAAGCCATTCGCGAGGCGCTGGAAGCCATTCTGCACGCCTTCTCACCGGAAGCCCTGTTGCGCC
GGTTTCACGGCTATCGCCGTGGTTTGCAGGAAAACGAAGACGAGGGCCGCTGGGCCTGGGATATGTACCA
ACACTATTACCGTGAACTGAAATCCAGTCGTCAGCAGGGTTTCGAACGCCTGTTCCAGGAAGTGTTCGAC
CAGGCTTATGACCAACACTTGCGCCAATTACAGAGGGAGAAACTGTTGTGA
 Primer design