SecReT6
Protein ID: 120556634
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3729
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4139874..4140890 [-]
Producthypothetical protein
NoteTssG
UniProt IDA1U729
KEGG IDmaq:Maqu_3729
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-102, Aligned region: 21..321
Protein Sequence: 338 a.a.     [Download]
>gi|120556634|ref|YP_960985.1| hypothetical protein Maqu_3729 [Marinobacter aquaeolei VT8]
MDVTARSAAADVAGLEPVLGNARRYSFFQLVDLIHRHHGDDLERGGHDEPRQERIRFSASAGLGFPGSDV
VSALSPEHEHAPYQMEVSFLGLHGSQSPLPGYYLEDLAWEAGQNLGVRRHFLDFFNHRLVTLFHRAWRKY
RYYIRFQPGASDGFSELVFALTGLGDSRLREATPVNWSKMLAYAGLMAGRSRSPEVVSGIIGHCFDLDDV
SIEQWVLRKVDIARDQQTSLGRANATLGEDTLVGSRIRDRSGKFILRLRNLTRQRFADFLPNGRDHQRLV
KLVEFATREQLAYDLELQMRPKDIRPMQLGEDVRLGWNSFVTPDRARERPAVRIQIRR
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4140890-4139874 Marinobacter aquaeolei VT8, complete genome
ATGGACGTTACAGCAAGGTCAGCAGCCGCTGATGTAGCCGGGCTGGAACCCGTTCTCGGCAACGCGCGGC
GATACAGCTTTTTTCAGCTGGTGGATCTGATTCACCGGCACCATGGAGACGACCTGGAGCGTGGCGGTCA
CGATGAGCCCCGCCAGGAACGCATCCGGTTCTCGGCCTCGGCCGGCCTGGGGTTTCCTGGCAGTGATGTG
GTGTCGGCGCTGTCGCCGGAGCATGAGCACGCCCCCTATCAGATGGAAGTCAGCTTTCTGGGGCTTCACG
GCTCCCAGTCGCCACTGCCCGGTTATTACCTGGAAGATCTGGCCTGGGAAGCGGGGCAGAATCTCGGTGT
TCGTCGGCATTTTCTCGATTTCTTTAATCACCGGCTGGTGACCCTGTTCCATCGGGCCTGGCGCAAATAC
CGGTACTACATCCGATTCCAGCCCGGGGCCAGCGACGGTTTTTCGGAACTGGTGTTTGCTCTGACCGGTT
TGGGCGACAGTCGGCTGCGGGAAGCGACACCGGTGAACTGGTCCAAGATGCTGGCCTATGCCGGCTTGAT
GGCGGGCCGGAGCCGGTCACCGGAAGTGGTCAGCGGTATCATCGGCCACTGCTTTGACCTGGACGACGTC
AGCATCGAACAGTGGGTACTGCGCAAAGTGGACATCGCCCGGGATCAGCAAACCTCGCTGGGCAGGGCCA
ACGCCACCCTGGGCGAAGACACGCTGGTGGGTTCGCGCATCCGGGATCGCAGCGGCAAGTTCATTCTCCG
GCTGCGCAATCTGACTCGGCAGCGGTTTGCGGATTTTCTGCCTAATGGCCGGGATCACCAGCGCCTGGTC
AAACTGGTGGAGTTCGCTACCCGGGAGCAGCTGGCCTATGACCTGGAGCTGCAAATGCGGCCCAAGGATA
TTCGCCCCATGCAACTGGGCGAGGATGTTCGCCTGGGCTGGAATTCCTTCGTAACACCGGACCGGGCCCG
TGAGCGTCCGGCGGTGCGGATACAGATCAGACGGTAG
 Primer design