SecReT6
Protein ID: 120556635
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3730
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4140854..4142626 [-]
Producthypothetical protein
NoteTssF
UniProt IDA1U730
KEGG IDmaq:Maqu_3730
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.60E-210, Aligned region: 3..590
Protein Sequence: 590 a.a.     [Download]
>gi|120556635|ref|YP_960986.1| hypothetical protein Maqu_3730 [Marinobacter aquaeolei VT8]
MKLNRFYRDELSFLRLQGREFAEAHPQLTRFLSEQSTDPDVERLLEGFAFLTGKLREKVEDEFPELTHSL
LNMLWPNYLRPVPSCTIMRFDPQLHAISERQVVDRHTEIKSRPLGDASRQTQCRFRTCRSVDIFPISVAD
ANAEHSREVSSVTVDLALHTDQPLNGIGLENLRFYLGGDNHTAETLYLWLNHYLSRMELVVGDRVVSLPS
SLLQPVGFAADEAILPYPKNAYAGYRIIQEYLSFPEAFRFVDITGLKSRLPAVQADEISLRFHFSRILPP
DTRVTRDSMQLYCTPAVNLFSHEGEPVDLNGRQTEYRISPSSRCPEHYEVFSIEQVEGWLEGRSGRGEPR
IYTAFESFQHEVERDRGRTALYYRVRTRESVRGDGFDHYISFVRGDETECLNRQEAVSLTLTCTNRQLPQ
QLAVGEVCMATESTPAFAAFSNITRPTATLRPTLDGSLLWTLISNLSLNYLSMLDVDALRTVLRVYDFRA
LVDRQAERVSQKRLAGITGITTKPVDRMIRGLPVRGIRSELQLDQHGFASEGDLYLFGTVLSQFFALYAS
INAFHQLEVVNTDNQERYTWTLQQGQQPLM
 
Nucleotide Sequence: 1773 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4142626-4140854 Marinobacter aquaeolei VT8, complete genome
ATGAAGTTAAACAGGTTCTACAGGGATGAGTTGAGCTTTCTGCGGTTGCAAGGCAGGGAATTTGCCGAAG
CCCACCCGCAGCTCACCCGCTTTCTATCCGAACAGAGCACCGACCCGGACGTAGAACGGCTTCTGGAAGG
CTTCGCCTTCCTGACCGGCAAACTGCGGGAAAAAGTTGAGGACGAGTTTCCGGAGCTGACTCATTCGCTG
CTGAACATGCTCTGGCCCAATTATCTGAGGCCAGTGCCCAGCTGCACCATCATGCGCTTTGATCCACAGC
TGCATGCCATCAGTGAACGTCAGGTTGTTGATCGTCATACCGAGATCAAGAGCCGCCCCCTGGGCGACGC
CAGCCGCCAGACCCAATGCCGGTTCCGCACCTGCCGGTCGGTGGATATTTTTCCGATCAGTGTGGCCGAT
GCCAATGCCGAGCACTCACGGGAAGTTTCCTCCGTGACCGTAGACCTGGCCCTGCATACGGACCAGCCAC
TGAATGGCATTGGCCTGGAAAATCTGCGTTTTTACCTGGGGGGCGACAACCACACGGCAGAGACCCTGTA
TCTGTGGTTAAACCATTACCTCAGCCGTATGGAGCTGGTGGTGGGCGACCGTGTGGTCAGTCTGCCTTCA
TCCCTGTTGCAGCCGGTTGGCTTTGCGGCAGATGAGGCGATCCTGCCTTACCCCAAGAATGCTTATGCCG
GCTACCGGATTATCCAGGAGTACCTGAGTTTTCCGGAGGCCTTCCGGTTTGTTGATATCACCGGCCTGAA
ATCCCGATTGCCAGCGGTGCAGGCTGATGAGATCAGTCTGCGTTTCCACTTCAGCCGGATTTTGCCCCCG
GACACCCGGGTAACCCGCGACTCCATGCAGTTGTACTGCACCCCCGCGGTTAATCTGTTCAGCCACGAAG
GCGAGCCGGTAGACCTGAACGGTCGCCAGACTGAATACCGTATTTCACCCTCCAGCCGCTGCCCGGAACA
CTACGAGGTGTTCAGTATCGAGCAGGTTGAGGGCTGGCTGGAAGGTCGTTCCGGTAGAGGCGAGCCGCGC
ATCTACACGGCGTTCGAGAGTTTCCAGCATGAAGTGGAGCGAGATCGCGGCCGTACCGCCCTGTACTACC
GGGTACGTACCCGGGAGAGCGTGCGTGGTGATGGTTTTGATCACTACATTTCCTTTGTTCGCGGTGATGA
AACCGAATGTCTGAATCGTCAGGAAGCGGTCTCGCTCACGCTCACCTGCACCAATCGCCAGTTGCCACAA
CAACTGGCCGTCGGGGAAGTGTGCATGGCCACCGAGAGCACACCGGCCTTTGCCGCATTCAGCAATATCA
CGCGCCCGACGGCGACCCTGCGGCCTACCCTGGATGGCAGCCTGTTGTGGACGCTGATATCCAACCTGTC
ATTGAACTACCTGTCGATGCTGGATGTGGATGCCCTGCGCACCGTGCTGCGAGTGTATGACTTCCGGGCC
CTCGTCGACCGACAGGCTGAGCGGGTGTCCCAGAAGCGGCTGGCCGGTATCACGGGCATCACCACCAAGC
CGGTTGACCGCATGATTCGCGGGCTGCCGGTGCGCGGTATCCGCTCAGAGCTGCAGCTGGATCAGCATGG
GTTTGCCAGTGAAGGTGACCTCTACCTGTTCGGCACGGTGTTGAGCCAGTTTTTTGCGCTTTACGCGAGT
ATCAATGCGTTTCACCAACTGGAAGTGGTGAATACAGACAATCAGGAACGGTACACATGGACGTTACAGC
AAGGTCAGCAGCCGCTGATGTAG
 Primer design