SecReT6
Protein ID: 120556636
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3731
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4142925..4143362 [-]
Producthypothetical protein
NoteTssE
UniProt IDA1U731
KEGG IDmaq:Maqu_3731
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.00E-20, Aligned region: 36..124
Protein Sequence: 145 a.a.     [Download]
>gi|120556636|ref|YP_960987.1| hypothetical protein Maqu_3731 [Marinobacter aquaeolei VT8]
MFGGTGTDGVRNTGSLFERLEQAAAPAGQSMGEFTHVVESIKRHLVRLLNAHPGNSSSAPDLGLLDFNDA
TLGTHDLSIQIRGAIRQCIEKFEPRVKRVDVVAMPPGPDPLQLKFQVTVYLNVAGSDDRTTIDLVLDDKR
YYRVV
 
Nucleotide Sequence: 438 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4143362-4142925 Marinobacter aquaeolei VT8, complete genome
GTGTTTGGCGGCACCGGCACTGACGGCGTTCGCAACACCGGCAGCCTGTTTGAACGGCTTGAACAGGCTG
CCGCTCCTGCGGGCCAGAGCATGGGGGAGTTCACTCATGTGGTTGAGTCCATCAAGCGCCACCTGGTGCG
ACTGCTGAACGCCCACCCGGGCAACAGCAGCAGCGCACCGGATCTTGGCTTGCTGGATTTCAACGACGCC
ACGCTGGGCACTCATGACCTGAGCATCCAGATTCGCGGGGCCATCCGTCAGTGCATTGAGAAGTTTGAGC
CGCGGGTTAAGCGGGTGGATGTGGTGGCTATGCCACCGGGCCCGGACCCGTTGCAGTTGAAGTTCCAGGT
GACGGTCTACCTGAACGTTGCAGGAAGCGATGATCGGACGACGATAGACCTGGTTTTGGATGATAAGCGG
TACTACCGGGTTGTTTAG
 Primer design