SecReT6
Protein ID: 120556637
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3732
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4143366..4144847 [-]
Producthypothetical protein
NoteTssC
UniProt IDA1U732
KEGG IDmaq:Maqu_3732
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.00E-193, Aligned region: 66..491
Protein Sequence: 493 a.a.     [Download]
>gi|120556637|ref|YP_960988.1| hypothetical protein Maqu_3732 [Marinobacter aquaeolei VT8]
MSDTAVQQSAASESVAEGSLLDQVMANSRMAPADEGYDVARKGVATFIANLLKSDEKGQPVNKALVDQMV
VELDRKISAQMDEILHAPKLQELESSWRGLKLMVDRTDFRENIKVDILHATKTELLEDFEFAPDVTQTGF
YKHIYAAEYGQFGGEPVGAIVGNYAFSPSTPDMKLLQYVSSVGAMSHAPFLSSVAPSFFGVDSYQELPAI
KELSAVFEGPKYAKWRSLRESEDARYLGLTAPRFLLRVPYDPTENPVRSFNYKEDVSGDHEHYLWGNTSY
LLATRLTESFAKYRWCPNIIGPQSGGAVEDLPVHTFESFGQLEAKIPTEVLITDRREYELAEEGFIALTM
RKGSDNAAFFSANSVQKPKQFPNTKEGKEAETNYKLGTQLPYMMIVNRLAHYIKVLQREQIGSWKERQDL
ERELNTWIRQYVADQENPPADVRSRRPLRAAKVEVSDVEGDPGWYQVSLAVRPHFKYMGANFELSLVGRL
DKD
 
Nucleotide Sequence: 1482 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4144847-4143366 Marinobacter aquaeolei VT8, complete genome
ATGTCTGATACTGCTGTGCAGCAATCTGCTGCCTCCGAATCCGTAGCAGAAGGCTCTCTGCTTGACCAGG
TCATGGCCAACAGCCGTATGGCGCCGGCCGATGAAGGCTACGATGTTGCCCGTAAAGGGGTGGCCACGTT
TATTGCCAACCTGCTGAAGAGCGATGAAAAAGGCCAGCCGGTCAACAAGGCGCTGGTCGACCAGATGGTG
GTCGAGCTGGATCGCAAAATCAGCGCCCAGATGGATGAGATTCTGCACGCGCCCAAGCTGCAGGAACTGG
AATCGTCCTGGCGTGGCCTGAAATTGATGGTGGATCGCACCGATTTCCGCGAGAACATCAAGGTGGATAT
CCTCCATGCCACCAAGACCGAACTGCTGGAAGATTTCGAATTTGCTCCGGACGTGACCCAGACCGGCTTC
TACAAGCACATCTATGCGGCCGAGTATGGTCAGTTCGGTGGTGAGCCGGTGGGCGCGATTGTCGGCAACT
ACGCCTTCAGCCCATCAACGCCGGACATGAAGCTGCTGCAGTACGTGTCGTCGGTTGGCGCCATGTCCCA
CGCGCCGTTCCTGTCCTCGGTTGCACCGTCGTTCTTCGGCGTCGACAGCTACCAGGAACTGCCGGCTATC
AAAGAGCTGAGCGCCGTTTTCGAAGGGCCGAAATACGCCAAGTGGCGTTCCCTGCGGGAATCTGAGGATG
CCCGTTACCTGGGCCTGACCGCACCGCGCTTCCTGCTGCGGGTGCCTTACGATCCGACTGAAAACCCGGT
GCGCAGCTTCAACTATAAGGAAGATGTCTCCGGTGACCACGAGCATTACCTGTGGGGCAATACCTCCTAC
CTGCTGGCCACACGCCTGACCGAGAGCTTTGCCAAGTACCGTTGGTGCCCGAACATCATTGGTCCACAGA
GTGGCGGTGCGGTGGAAGATCTGCCGGTGCACACCTTCGAGTCCTTCGGTCAGCTGGAAGCCAAGATTCC
GACTGAGGTACTGATTACCGACCGTCGCGAATACGAGCTGGCGGAAGAAGGTTTCATCGCCCTGACCATG
CGTAAAGGCAGCGATAACGCCGCGTTCTTCTCCGCCAACTCAGTGCAGAAGCCCAAGCAGTTCCCGAACA
CCAAGGAAGGCAAGGAAGCGGAAACCAACTACAAGTTGGGTACCCAGTTGCCGTACATGATGATCGTGAA
CCGCCTGGCCCACTACATCAAGGTGCTGCAGCGAGAGCAGATCGGCTCCTGGAAAGAGCGTCAGGATCTG
GAGCGGGAACTGAACACCTGGATTCGCCAGTACGTGGCCGACCAGGAAAACCCGCCCGCGGACGTCCGCA
GCCGCCGCCCCTTGCGTGCCGCGAAAGTGGAAGTCTCCGATGTAGAAGGTGATCCGGGCTGGTACCAGGT
CTCCCTGGCAGTGCGTCCGCACTTCAAATACATGGGCGCCAACTTTGAACTCTCGCTGGTTGGCCGACTG
GACAAGGATTAA
 Primer design