SecReT6
Protein ID: 120556638
SecReT6 ID163
T6SS typei1
Gene symbol-
Locus tagMaqu_3733
StrainMarinobacter aquaeolei VT8
Repliconchromosome [GenBank: NC_008740] [Browse all T6SS(s) in this replicon]
Location [Strand]4144909..4145406 [-]
Producthypothetical protein
NoteTssB
UniProt IDA1U733
KEGG IDmaq:Maqu_3733
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.10E-58, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|120556638|ref|YP_960989.1| hypothetical protein Maqu_3733 [Marinobacter aquaeolei VT8]
MSAKDGSVAPKERINIKYVPATGDQQAETELPLKMFVVGDFKGHAEETPIEDRKAISVDKNNFRSVMKEA
GLTLSTSVSNKLEDGADDLPVNLEFQGLEDFSPDSIARQVPELKKLIELREALVALKGPLGNVPSFRSKL
QELLDNDDAREKLLAELELATDGGE
 
Nucleotide Sequence: 498 bp     [Download]
>gi|120552944|ref|NC_008740.1|:c4145406-4144909 Marinobacter aquaeolei VT8, complete genome
ATGTCTGCCAAAGACGGTTCCGTTGCGCCGAAAGAGCGCATCAATATCAAGTATGTCCCCGCCACAGGCG
ATCAGCAGGCCGAAACCGAACTACCACTGAAGATGTTCGTGGTTGGTGATTTCAAGGGTCACGCTGAAGA
AACCCCCATTGAAGACCGTAAGGCCATTTCCGTCGACAAGAACAACTTCCGTTCTGTCATGAAGGAAGCG
GGTCTGACGCTTTCCACCAGTGTTTCCAACAAGCTCGAAGACGGTGCCGACGACCTCCCCGTGAATCTCG
AATTCCAGGGGCTCGAAGACTTTTCTCCGGACAGCATTGCCCGCCAGGTCCCTGAGCTCAAGAAGCTGAT
TGAGCTGCGTGAAGCCCTGGTTGCCCTCAAGGGCCCGCTGGGCAACGTGCCTTCGTTCCGTTCCAAGCTG
CAGGAGCTGCTGGACAACGACGACGCCCGGGAAAAGCTGTTGGCTGAACTTGAGCTGGCCACCGACGGCG
GCGAGTAA
 Primer design