SecReT6
Protein ID: 120610160
SecReT6 ID164
T6SS typei3
Gene symbol-
Locus tagAave_1473
StrainAcidovorax citrulli AAC00-1
Repliconchromosome [GenBank: NC_008752] [Browse all T6SS(s) in this replicon]
Location [Strand]1627945..1631574 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDA1TM76
KEGG IDaav:Aave_1473
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.70E-94, Aligned region: 518..833
ImcF-related_N [PF14331], Evalue: 2.30E-94, Aligned region: 205..470
ImcF-related_N [PF14331], Evalue: 2.30E-94, Aligned region: 1062..1074
DUF1215 [PF06744], Evalue: 2.10E-33, Aligned region: 946..1069
FtsK_SpoIIIE [PF01580], Evalue: 0.0056, Aligned region: 140..156
FtsK_SpoIIIE [PF01580], Evalue: 0.0056, Aligned region: 421..441
Protein Sequence: 1209 a.a.     [Download]
>gi|120610160|ref|YP_969838.1| unnamed protein product [Acidovorax citrulli AAC00-1]
MLRKIFSFFFNRFTLVLCGLVLLSLLVWFVGPLVYIKPYQPLESEAVRGWIIAALFGIWFLRLFIRWWRA
KEMNARLLGQLARIGASDASAPEAGPGKEEVAELEKRFKEAVDVLGKTRFGQTEQGWFGRLSRRYLYQLP
WYLIIGSPGSGKTTALVNSGLDFPLAAQFGKASIRGVGGTRNCDWWFTDQAVLLDTAGRYTTQESDEAQD
SAAWSGFLGLLRRFRGRQPINGVLVTLSVQELLSGGDAERERLARLIGLRLAELCEGLSIKFPVYVLVTK
TDLLAGFNEFFGNMTREERAQVWGFTNPYVEGQAQEDPGLQFRKEFDGLADQINRLLPQRLLAEPDLARR
GQIYGLPQQFVGLRDVVQQTLSTIFASSRFKEKPLFRGVYFTSGTQEGMPFDRVLSALSRRFSVAPPAHP
AGEGRAGKSYFIETLLKGVIFNEAGLTGRNAKKERQLRLLQAAGFFALAAGLAGATIAWTISHGNNQKYL
DEVAAKVPTLKQAVEESRDADPENMVALLPLLNHAEALAVSQRYTGDSPPLSWRYGLLQVPKVQTAADAT
YMRLLEDAWLPRLARHLRNSLQQASTANPEASYEALKVYLMLYDPERFNPRVVKAWMLNEWEATLPPALV
QSGMLDQLAHHLDRLMEDRALVSPIPIDQPLVDEVRQRLAQLSPAQRAYSRLKQLLTTGTALPPDFTLVR
AAGPEAPQVFTRRSGKPLTQGISGLFTYDGYYGVFSHELPKVTSLLAQEETWVLGKAQGQRSVANEVMTG
QLALEVKRLYLMEYAKVWEDFLADVRPVQVASLDQAGEQARLYSSANSSLEQFIRAVAKETTLGQKPGAG
GSSTSSWLGEKINRIKEEQEQLSRLTGKRVNIGGLAASTNLEADLVDFRFREYRRLATSNGSGPAPIAAS
LQVLNEAAAVISSARQQISAGGTVPPSLSPALERVRMEAKRVPPPLNTMYEDLASSTSAMVGRDVRATVG
SNLNATIGTFCRRAIGGRYPFTKGSASDVTSDDFASLFSPGGMMDEFFRNTLQPMVDISTTPWRFRQGVD
GTPVGGSAALASFQRAATIRDVYFRAGGKVPSIRMDIKPLEMDASISQMVLDIDGEVLRYQHGPQIPKSM
AWPGTRGTGQVRLQITGGGAENTGLVTEGPWAVHRFFDKAQILPGSTPERFVAAFDIGGRKLRFEVTTGS
VLNPFRLKAMEEFACPGNL
 
Nucleotide Sequence: 3630 bp     [Download]
>gi|120608714|ref|NC_008752.1|:1627945-1631574 Acidovorax citrulli AAC00-1 chromosome, complete genome
ATGCTGCGCAAGATCTTTTCATTCTTCTTCAACCGGTTCACGCTGGTGCTGTGCGGCCTGGTGCTGCTCA
GCCTGCTGGTCTGGTTCGTCGGTCCGCTGGTCTATATCAAGCCCTACCAGCCGCTCGAGAGCGAGGCGGT
GCGCGGCTGGATCATCGCCGCGCTGTTCGGCATCTGGTTCCTGCGGCTGTTCATCCGGTGGTGGCGGGCC
AAGGAGATGAATGCACGCCTGCTGGGCCAGCTGGCCCGCATCGGCGCATCGGATGCCTCCGCCCCCGAGG
CCGGTCCCGGCAAGGAGGAGGTGGCCGAACTCGAGAAGCGCTTCAAGGAGGCGGTCGATGTCCTGGGCAA
GACCCGCTTCGGGCAGACGGAGCAGGGCTGGTTCGGCCGGCTGTCCCGCCGCTACCTCTACCAGTTGCCC
TGGTACCTCATCATCGGTTCTCCGGGATCCGGCAAGACCACGGCACTGGTCAATTCGGGCCTCGATTTTC
CTCTGGCCGCCCAGTTCGGCAAGGCGTCGATCCGCGGCGTCGGCGGCACGCGCAACTGCGACTGGTGGTT
CACCGACCAGGCCGTGCTGCTGGATACCGCCGGCCGCTACACCACGCAGGAGAGCGACGAGGCGCAGGAC
AGTGCCGCCTGGTCGGGGTTCCTCGGCCTGCTGCGGCGCTTTCGCGGGCGGCAGCCCATCAACGGGGTGC
TGGTCACCCTCAGCGTGCAGGAGCTGCTGAGCGGCGGCGATGCGGAGCGCGAGCGCCTGGCCCGGCTGAT
CGGCCTGCGCCTGGCCGAGCTGTGCGAGGGGCTGTCCATCAAGTTCCCGGTGTACGTGCTGGTCACCAAG
ACCGACCTGCTGGCCGGCTTCAACGAGTTCTTCGGCAACATGACCCGCGAGGAGCGGGCACAGGTCTGGG
GCTTCACCAATCCCTATGTGGAAGGGCAGGCGCAGGAAGACCCGGGGCTGCAGTTCCGCAAGGAATTCGA
CGGCCTGGCCGACCAGATCAACCGGTTGCTGCCGCAGCGCCTGCTGGCGGAGCCCGACCTCGCGCGCCGT
GGCCAGATCTATGGCCTGCCGCAGCAGTTCGTCGGCCTGCGGGACGTGGTCCAGCAGACGCTGTCCACGA
TCTTCGCGTCCTCGCGTTTCAAGGAAAAGCCGCTGTTCCGCGGCGTCTATTTCACCAGTGGCACGCAGGA
GGGCATGCCGTTCGACCGGGTGCTGTCCGCCCTGTCGCGGCGCTTCTCGGTGGCGCCTCCGGCCCATCCC
GCCGGGGAAGGGCGCGCGGGCAAGAGCTATTTCATCGAGACCCTGCTCAAGGGGGTCATCTTCAACGAGG
CCGGGCTGACGGGACGCAATGCCAAGAAGGAGCGCCAGTTGCGGCTGCTGCAGGCCGCCGGCTTTTTCGC
CCTGGCCGCGGGGCTGGCGGGCGCCACGATCGCCTGGACGATCAGCCACGGCAACAACCAGAAATACCTG
GACGAGGTGGCCGCGAAGGTGCCCACGCTCAAGCAGGCGGTGGAGGAATCCCGCGACGCGGATCCCGAGA
ACATGGTGGCGCTGCTGCCGCTGCTGAACCACGCCGAGGCCCTCGCCGTGAGCCAGCGCTACACCGGCGA
TTCGCCGCCGCTCAGCTGGCGCTACGGATTGCTGCAGGTGCCCAAGGTGCAGACCGCTGCCGACGCGACC
TACATGCGGCTGCTGGAGGATGCGTGGCTGCCCCGCCTCGCGCGGCACCTGCGCAATTCGCTGCAGCAGG
CCTCGACGGCCAACCCCGAGGCCAGCTACGAGGCGCTCAAGGTCTATCTGATGCTCTACGATCCGGAGCG
CTTCAACCCCCGCGTGGTGAAGGCCTGGATGCTCAACGAGTGGGAAGCCACGCTGCCCCCGGCCCTGGTG
CAGTCGGGCATGCTGGACCAGCTGGCGCACCACCTCGACCGGCTCATGGAAGACCGTGCCCTGGTTTCGC
CGATTCCGATAGACCAGCCGCTGGTGGACGAGGTGCGCCAACGGCTGGCGCAGCTGTCGCCTGCGCAGCG
GGCCTACAGCCGGCTGAAGCAGTTGCTGACCACGGGCACGGCGCTGCCGCCGGACTTCACGCTGGTGCGG
GCCGCCGGCCCCGAGGCGCCGCAGGTGTTCACGCGGCGCAGCGGCAAGCCGCTCACTCAGGGGATTTCTG
GACTGTTCACCTACGACGGCTACTACGGCGTGTTCTCGCATGAGCTGCCCAAGGTGACCTCGCTGCTGGC
GCAGGAGGAAACCTGGGTGCTGGGCAAGGCGCAGGGGCAGCGCAGCGTGGCCAACGAGGTCATGACCGGG
CAGCTCGCGCTCGAGGTCAAGCGCCTCTACCTCATGGAGTACGCCAAGGTCTGGGAGGACTTCCTCGCCG
ATGTGCGGCCCGTGCAGGTGGCGTCGCTCGACCAGGCCGGCGAGCAGGCGCGGCTGTATTCGTCCGCCAA
TTCCAGCCTGGAGCAGTTCATCCGCGCGGTGGCCAAGGAAACCACGCTGGGTCAGAAGCCGGGGGCCGGC
GGCAGCAGCACCAGCAGCTGGCTGGGCGAGAAGATCAACCGCATCAAGGAGGAGCAGGAGCAGCTCAGCC
GCCTCACCGGCAAGCGGGTGAACATCGGCGGGCTCGCGGCCAGCACCAACCTCGAGGCCGATCTGGTGGA
CTTCCGCTTCCGCGAATACCGCCGTCTCGCCACCTCCAACGGATCGGGCCCGGCGCCCATCGCCGCCAGC
CTGCAGGTGCTCAACGAAGCCGCCGCGGTCATCTCGTCCGCGCGCCAGCAGATCAGTGCCGGCGGCACCG
TGCCGCCGTCGCTCTCGCCGGCCCTGGAGCGCGTGCGCATGGAGGCCAAGCGCGTGCCGCCGCCCCTCAA
CACCATGTACGAGGATCTGGCATCGTCCACGTCGGCCATGGTAGGCCGCGACGTGCGTGCCACCGTGGGC
AGCAACCTCAATGCCACCATCGGGACGTTCTGCCGCAGGGCGATCGGCGGCCGCTATCCCTTCACCAAGG
GATCGGCCAGCGACGTGACGAGCGACGACTTCGCCAGCCTGTTCTCGCCGGGCGGCATGATGGACGAGTT
CTTCCGCAACACCCTGCAGCCGATGGTGGACATCTCCACCACCCCCTGGCGCTTCCGCCAGGGTGTCGAT
GGGACGCCGGTCGGTGGATCGGCCGCGCTGGCCTCGTTCCAGCGCGCCGCGACCATCCGCGACGTGTATT
TCCGGGCGGGCGGCAAGGTGCCGTCCATCCGCATGGACATCAAGCCGCTGGAAATGGACGCCTCCATTTC
GCAGATGGTGCTGGACATCGACGGCGAGGTGCTGCGCTACCAGCACGGCCCGCAGATCCCGAAATCGATG
GCCTGGCCCGGCACCCGGGGCACGGGCCAGGTCCGCCTGCAGATCACCGGGGGCGGTGCCGAGAACACGG
GCCTGGTGACCGAGGGACCCTGGGCCGTGCACCGTTTCTTCGACAAGGCCCAGATTCTGCCGGGCAGCAC
GCCCGAGCGCTTCGTCGCCGCCTTCGATATCGGCGGGCGCAAGCTGCGCTTCGAGGTCACCACGGGCAGC
GTGCTCAACCCGTTCCGTCTCAAGGCCATGGAGGAGTTCGCGTGTCCTGGCAATCTCTGA
 Primer design