SecReT6
Protein ID: 121596593
SecReT6 ID165
T6SS typei1
Gene symbol-
Locus tagBMASAVP1_0610
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]618063..621155 [+]
ProductATP-dependent Clp protease, ATP-binding subunit ClpB
NoteTssH
UniProt IDA1UW65
KEGG IDbmv:BMASAVP1_0610
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-41, Aligned region: 226..244
AAA_2 [PF07724], Evalue: 1.20E-41, Aligned region: 688..855
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 227..336
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 694..812
ClpB_D2-small [PF10431], Evalue: 5.50E-14, Aligned region: 860..932
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 227..245
AAA_5 [PF07728], Evalue: 1.70E-13, Aligned region: 693..807
AAA_22 [PF13401], Evalue: 1.10E-09, Aligned region: 224..310
AAA_22 [PF13401], Evalue: 1.10E-09, Aligned region: 409..439
AAA_22 [PF13401], Evalue: 1.10E-09, Aligned region: 692..787
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 37..117
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 269..307
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 418..466
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 664..729
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 758..787
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 831..894
AAA_16 [PF13191], Evalue: 3.50E-09, Aligned region: 893..972
Zeta_toxin [PF06414], Evalue: 3.40E-06, Aligned region: 225..245
Zeta_toxin [PF06414], Evalue: 3.40E-06, Aligned region: 305..353
Zeta_toxin [PF06414], Evalue: 3.40E-06, Aligned region: 687..734
Clp_N [PF02861], Evalue: 1.20E-05, Aligned region: 28..75
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 116..131
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 220..247
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 436..467
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 500..511
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 593..608
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 691..725
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 894..918
AAA_25 [PF13481], Evalue: 1.40E-05, Aligned region: 225..302
AAA_25 [PF13481], Evalue: 1.40E-05, Aligned region: 461..510
AAA_25 [PF13481], Evalue: 1.40E-05, Aligned region: 689..714
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 219..253
IstB_IS21 [PF01695], Evalue: 0.00013, Aligned region: 693..729
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 203..239
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 276..374
Arch_ATPase [PF01637], Evalue: 0.00017, Aligned region: 692..714
Sigma54_activat [PF00158], Evalue: 0.00021, Aligned region: 221..239
Sigma54_activat [PF00158], Evalue: 0.00021, Aligned region: 692..809
AAA_17 [PF13207], Evalue: 0.00024, Aligned region: 227..249
AAA_17 [PF13207], Evalue: 0.00024, Aligned region: 693..729
ResIII [PF04851], Evalue: 0.00036, Aligned region: 210..246
ResIII [PF04851], Evalue: 0.00036, Aligned region: 292..307
ResIII [PF04851], Evalue: 0.00036, Aligned region: 664..727
TIP49 [PF06068], Evalue: 0.0006, Aligned region: 226..251
TIP49 [PF06068], Evalue: 0.0006, Aligned region: 273..305
TIP49 [PF06068], Evalue: 0.0006, Aligned region: 693..728
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 223..245
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 288..313
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 400..488
AAA_10 [PF12846], Evalue: 0.001, Aligned region: 693..840
NACHT [PF05729], Evalue: 0.0016, Aligned region: 227..253
NACHT [PF05729], Evalue: 0.0016, Aligned region: 693..714
Torsin [PF06309], Evalue: 0.0048, Aligned region: 651..719
AAA_14 [PF13173], Evalue: 0.0069, Aligned region: 278..328
AAA_14 [PF13173], Evalue: 0.0069, Aligned region: 692..775
AAA_18 [PF13238], Evalue: 0.0071, Aligned region: 228..245
AAA_18 [PF13238], Evalue: 0.0071, Aligned region: 694..735
Protein Sequence: 1030 a.a.     [Download]
>gi|121596593|ref|YP_990218.1| ATP-dependent Clp protease, ATP-binding subunit ClpB [Burkholderia mallei SAVP1]
MLLVDLKPLIEQLNPYCRNALESAVGACVARRHDDVAVEHLLARLCDEPSADVALLLRACGADAARLRRQ
ADAALDARPAGDGGRPAFAPSLLALLQDAWLIASLELGDTHIRSAAVLAAAVARAARQPSPGGDDVLQSL
RKDALVARFASGACARSIESRASGALDAAPGEASDTRDASSAIARYCEDFTAKARAGGIDPVFGRDAEIR
QIVDILARRRKNNPVCVGEPGVGKTAVVEGLALRIAEGDVPATLRGATLLGLDLGMLQAGASVKGEFEQR
LKRVIAEIRASQTPVVLFIDEAHTLIGAGGAAGASDAANLLKPALARGELRTIAATTWSEYKKYFEKDAA
LARRFQPVKLDSPDVATSVMILRGLKERYQDAHGVTIRDDALVAAAELSARYITGRQLPDKAIDLLDTAC
ARVKVRQQTKPAALEDAQRAIQALERERRALRDELAERCAPDTPRVADIDRELAALSARAGALRDAWAAQ
RDAAQALVDARRACRAAADATAATDAAGTTGTAHAGELADSADVSDIADVAKMADAADAAPADAETGSSA
RDADARMPAGTCARVAPNPDARARPPLRAPHADARERAARALAEATRRFEHAQRDTPLVRIDVDPDAIAD
VVADWTGIAAGKLRRDRANVMLRLADTLRRRIRGQDHAIEQISEAVKAGAAGVHDPRRPLGVFLLAGPSG
TGKTETALAVADALFGDERSIVVVNMSEFQERHDVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSVVLLDE
VEKAHPDVLNLFYQVFDKGSLSDGEGKEVDFANTVIFLTSNLGADIIADIAARGARPDPDAMRAAVRPAL
SRHFKPALLARMTEIPYAPLAPDTLADIARLKLERIAARVAAQHATRIVYDDAVVAHVAARCTEVESGAR
NVDFILQRHVLPALAQHVLVCAGNAAPMPAIRVAIDAGGRFVVSNDAPADSDARDRSDASDAIDAVDAVD
AVDAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAPNAR
 
Nucleotide Sequence: 3093 bp     [Download]
>gi|121596444|ref|NC_008784.1|:618063-621155 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGCTGCTGGTTGACCTGAAACCGTTGATCGAACAGCTCAACCCCTATTGCCGGAACGCGCTCGAAAGCG
CCGTCGGCGCGTGCGTCGCGCGCCGGCACGACGACGTCGCCGTCGAGCACCTGCTCGCGCGGCTGTGCGA
CGAACCGTCGGCCGACGTCGCGCTGTTGCTGCGCGCGTGCGGCGCGGACGCGGCGCGCCTGCGCCGGCAG
GCCGACGCCGCGCTCGACGCGCGCCCGGCGGGCGACGGCGGCCGCCCCGCGTTCGCGCCGTCGCTGCTCG
CGCTGTTGCAGGACGCGTGGCTGATCGCGTCGCTCGAGCTCGGCGACACGCACATCCGCTCGGCGGCCGT
GCTCGCCGCCGCGGTCGCCCGCGCGGCGCGGCAGCCGTCGCCCGGCGGCGACGACGTGCTGCAGTCGCTG
CGCAAGGACGCGCTCGTCGCGCGCTTTGCGAGCGGCGCGTGCGCGCGATCGATCGAATCGCGCGCGTCCG
GCGCGCTCGACGCCGCGCCGGGCGAGGCGAGCGACACGCGCGACGCATCGAGCGCGATCGCCCGCTACTG
CGAGGACTTCACCGCGAAAGCGCGCGCCGGCGGGATCGATCCAGTCTTCGGTCGCGACGCGGAAATCCGC
CAGATCGTCGACATCCTCGCGCGGCGGCGCAAGAACAATCCGGTGTGCGTCGGCGAGCCGGGCGTGGGCA
AGACGGCCGTCGTCGAAGGGCTCGCGCTGCGGATCGCCGAAGGCGACGTGCCGGCGACGCTGCGCGGCGC
GACGCTGCTCGGCCTCGACCTAGGCATGCTGCAGGCGGGCGCGAGCGTGAAGGGCGAATTCGAGCAGCGG
CTCAAGCGCGTGATCGCCGAGATCCGCGCGTCGCAAACGCCCGTCGTGCTGTTCATCGACGAAGCGCACA
CGCTGATCGGCGCGGGCGGCGCGGCGGGCGCGTCCGACGCGGCGAACCTGCTGAAGCCCGCGCTCGCGCG
CGGCGAGCTGCGCACGATCGCAGCCACCACGTGGAGCGAATACAAGAAGTATTTCGAGAAGGACGCGGCG
CTCGCGCGGCGCTTCCAGCCGGTGAAGCTCGACAGCCCGGACGTCGCGACGTCGGTGATGATCCTGCGCG
GGCTGAAGGAGCGCTATCAGGACGCGCACGGCGTGACGATCCGCGACGACGCGCTCGTCGCCGCGGCCGA
GCTGTCGGCGCGCTACATCACCGGCCGGCAGTTGCCGGACAAGGCGATCGACCTGCTCGACACCGCGTGC
GCGCGCGTGAAGGTGCGCCAGCAGACCAAGCCCGCCGCGCTGGAGGACGCGCAGCGCGCGATCCAGGCGC
TCGAGCGCGAGCGGCGCGCGCTGCGCGACGAATTGGCCGAGCGCTGCGCGCCGGATACGCCGCGCGTCGC
CGACATCGATCGCGAGCTCGCCGCGCTGTCCGCGCGCGCCGGCGCGCTGCGCGACGCGTGGGCGGCGCAG
CGCGACGCCGCGCAGGCGCTCGTCGACGCACGCCGCGCGTGCCGGGCGGCGGCGGATGCAACGGCTGCAA
CGGATGCGGCTGGAACGACCGGAACGGCCCATGCCGGCGAGCTCGCCGATAGTGCCGACGTTTCCGATAT
CGCCGATGTCGCCAAGATGGCCGATGCGGCCGACGCCGCCCCTGCCGATGCCGAAACCGGCTCGAGCGCC
CGCGACGCCGACGCACGCATGCCCGCCGGGACGTGCGCGCGCGTCGCCCCGAACCCGGATGCGCGGGCGC
GGCCTCCTCTGCGCGCGCCGCACGCCGACGCGCGCGAGCGCGCGGCTCGTGCGCTCGCCGAAGCGACGCG
CCGCTTCGAGCACGCGCAGCGCGACACGCCGCTCGTGCGAATCGACGTCGATCCGGACGCGATCGCCGAC
GTCGTGGCCGACTGGACCGGCATCGCGGCCGGCAAGCTGCGCCGCGATCGCGCGAACGTGATGCTGCGGC
TCGCCGATACGCTGCGCCGCCGCATCCGCGGCCAGGATCACGCGATCGAACAGATCTCCGAAGCCGTGAA
GGCGGGCGCGGCCGGCGTCCACGATCCGCGCCGCCCGCTCGGCGTGTTCCTGCTCGCGGGGCCGTCGGGC
ACCGGCAAGACCGAGACCGCGCTCGCGGTCGCCGATGCGCTGTTCGGCGACGAGCGCTCGATCGTCGTCG
TCAACATGAGCGAATTCCAGGAGCGGCACGACGTGAGCCGCCTGATCGGCTCGCCGCCGGGCTACGTCGG
CTACGGCGAGGGCGGGATGCTGACCGAGGCGGTGCGCCAGCGGCCCTATTCGGTCGTGCTGCTAGACGAA
GTCGAGAAGGCGCACCCCGACGTGCTGAACCTGTTCTACCAGGTGTTCGACAAGGGTTCGCTGTCCGACG
GCGAAGGCAAGGAGGTCGACTTCGCGAACACGGTGATCTTCCTCACGTCGAATCTCGGCGCAGACATCAT
CGCCGACATCGCCGCGCGCGGCGCGCGGCCCGATCCGGACGCGATGCGCGCGGCGGTGCGCCCGGCGCTG
TCGCGCCATTTCAAGCCGGCGCTGCTCGCGCGGATGACCGAGATTCCGTATGCGCCGCTCGCGCCCGATA
CGCTCGCCGACATCGCGCGGCTGAAGCTCGAGCGCATCGCGGCGCGCGTCGCCGCGCAGCACGCGACGCG
CATCGTCTACGACGACGCCGTCGTCGCGCACGTCGCCGCGCGCTGCACCGAAGTCGAATCGGGCGCGCGC
AACGTCGATTTCATCCTGCAGCGCCACGTGCTGCCCGCGCTCGCGCAGCACGTGCTCGTGTGCGCGGGCA
ACGCGGCGCCGATGCCTGCGATTCGCGTCGCCATCGACGCCGGCGGCCGCTTCGTCGTCTCGAACGACGC
GCCGGCCGACTCCGATGCACGGGACCGGAGCGATGCGTCTGATGCGATCGACGCGGTCGATGCGGTCGAT
GCGGTCGATGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCA
ACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACC
CAACGCACGCTGA
 Primer design