SecReT6
Protein ID: 121596640
SecReT6 ID165
T6SS typei1
Gene symbol-
Locus tagBMASAVP1_0606
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]614324..614833 [+]
Producthypothetical protein
NoteTssD
UniProt IDA1UW61
KEGG IDbmv:BMASAVP1_0606
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.50E-24, Aligned region: 6..155
Protein Sequence: 169 a.a.     [Download]
>gi|121596640|ref|YP_990214.1| hypothetical protein BMASAVP1_0606 [Burkholderia mallei SAVP1]
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTITLTKEMDRSSP
QFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQYSPTPHKDDSNGIKEGLLGY
IEEIKFAYSGYSLEHAESGIAGAANWTNG
 
Nucleotide Sequence: 510 bp     [Download]
>gi|121596444|ref|NC_008784.1|:614324-614833 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGCTGGCCGGAATATATCTCAAGGTCAAAGGAAAAACCCAGGGGGAAATCAAAGGCTCCGTCGTTCAGG
AAGGTCATGACGGGAAGATCCACATCCTCGCCTTCAAGAACGACTACGACATGCCCGCCAGGCTCCAGGA
AGGCCTGACGCCCGCCGCCGCCGCTCGCGGCACGATCACGTTGACGAAGGAAATGGACAGATCGTCGCCG
CAATTCCTGCAGGCGCTCGGCAAGCGCGAGATGATGGAAGAGTTCGAGATCACGATCCACCGTCCGAAGA
CGGATACAACAGGTGGGGACCTGACCGAACTCCTGTTCACGTACAAGTTCGAAAAAGTGCTGATCACCCA
CATGGACCAATACTCGCCCACGCCGCACAAAGACGATAGCAACGGCATCAAGGAAGGCTTGCTCGGCTAT
ATCGAGGAGATCAAGTTCGCGTATTCGGGATACTCGTTGGAACACGCGGAATCGGGCATCGCGGGCGCCG
CAAACTGGACGAATGGCTGA
 Primer design