SecReT6
Protein ID: 121596763
SecReT6 ID166
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_0731
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]740418..741749 [-]
Producthypothetical protein
NoteTssM
UniProt IDA1UWI3
KEGG IDbmv:BMASAVP1_0731
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-29, Aligned region: 188..377
Protein Sequence: 443 a.a.     [Download]
>gi|121596763|ref|YP_990336.1| hypothetical protein BMASAVP1_0731 [Burkholderia mallei SAVP1]
MIRTSLRVFAAILIAILIWWVGPLFAFGIYHPLGPVWVREILVALVLIWGFWPTLARLWARLAMSPRQVK
VAPKAKQLDFVDKHLRTLDQQLKERWRKEPRGRWKRWVGALTREHRTMLPWYLVLGSEGSGKSSLVAKAV
SVSGSLQDRVLGSDATYGRGDDLNFRITREAVWFDVGGRWSLRAGADEAEFDAWRKLLRGMRRLRRGAPI
SGVVLCVDGLEMIDAPLDARKRLADSVRARLEEMREAFGQQVQVYVALNGLDRLDGAVSTLSLLEASKWV
KGVGFSLPDDGAHADAARADASWQHALQGLQQRVQQQVLYSAPAATEVSMNHAQLRFVETLSRLQKGLVA
WLHVALAPGEPHTAARLRGVWLGSMAELAEPHPAGAGGVGSAELPVPSRPLSELWTPLIRQVARARRGAR
AGRSRGAGAWARRCAGARCPSSR
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c741749-740418 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGATCCGCACGAGCTTGAGAGTATTCGCGGCGATTCTGATCGCGATCCTGATCTGGTGGGTGGGGCCGC
TGTTCGCGTTCGGCATCTATCACCCGCTCGGCCCGGTGTGGGTGCGCGAGATCCTCGTCGCACTGGTGCT
GATCTGGGGCTTCTGGCCGACGCTCGCGCGGCTCTGGGCGCGGCTCGCGATGAGCCCGCGGCAGGTGAAG
GTCGCGCCGAAGGCCAAGCAGCTCGATTTCGTCGACAAGCATCTGCGCACCCTCGACCAGCAGTTGAAGG
AGCGCTGGCGCAAGGAGCCGCGCGGCCGCTGGAAGCGCTGGGTCGGCGCGCTCACGCGCGAGCATCGCAC
GATGCTGCCGTGGTATCTGGTGCTCGGCTCCGAGGGTAGCGGCAAGTCGAGCCTCGTCGCGAAGGCGGTG
AGCGTGTCCGGCTCGCTGCAGGACCGGGTGCTCGGCTCGGACGCGACCTACGGGCGCGGCGACGACTTGA
ACTTCCGCATCACGCGCGAGGCGGTGTGGTTCGACGTCGGCGGCCGCTGGAGCCTGCGCGCGGGTGCCGA
CGAGGCCGAGTTCGACGCGTGGCGCAAGCTGCTGCGCGGGATGAGGCGGCTGCGCAGGGGCGCGCCGATC
AGCGGCGTCGTGCTGTGCGTCGACGGCCTCGAGATGATCGATGCGCCGCTCGACGCGCGCAAGCGGCTGG
CCGATTCGGTGCGCGCGCGGCTCGAGGAGATGCGCGAGGCGTTCGGCCAGCAGGTGCAGGTGTACGTTGC
GCTGAACGGGCTCGACCGGCTCGACGGCGCGGTCTCGACGCTGTCGCTGCTCGAGGCGTCGAAGTGGGTC
AAGGGCGTGGGCTTCAGCCTGCCCGACGACGGCGCGCACGCCGACGCCGCGCGCGCGGACGCGAGCTGGC
AGCACGCGCTGCAAGGGCTGCAGCAGCGGGTCCAGCAGCAGGTGCTGTATTCGGCGCCGGCGGCGACCGA
GGTGTCGATGAACCACGCGCAGTTGCGCTTCGTCGAGACGCTCAGCCGCCTGCAGAAGGGGCTCGTCGCG
TGGCTGCACGTCGCGCTCGCGCCGGGCGAGCCGCACACGGCCGCGCGGCTGCGCGGGGTGTGGCTGGGCT
CGATGGCCGAGCTCGCGGAGCCGCATCCGGCGGGCGCGGGCGGCGTCGGCTCGGCGGAGCTGCCCGTGCC
GTCGCGCCCGCTCAGCGAGCTGTGGACGCCGCTCATCCGGCAGGTGGCTCGAGCGCGACGCGGTGCCCGA
GCGGGCCGAAGTCGTGGCGCGGGCGCCTGGGCGAGGCGCTGCGCTGGGGCGCGGTGCCCCTCGTCGCGTT
GA
 Primer design