SecReT6
Protein ID: 121596777
SecReT6 ID166
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_0748
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]761493..762998 [-]
Producthypothetical protein
NoteTssC
UniProt IDA1UWK0
KEGG IDbmv:BMASAVP1_0748
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-183, Aligned region: 67..493
Protein Sequence: 501 a.a.     [Download]
>gi|121596777|ref|YP_990353.1| hypothetical protein BMASAVP1_0748 [Burkholderia mallei SAVP1]
MQQLESSAEKVVVDQNNVNEDLKDILRRSFRPRTNEAAEAVQNAVETLLTYARRSRVVVREDVAQTIEQL
VAELDKKISEQLTLVLHNKRFQSLEGAWRGLHYLVSNTDTSENLKIRYLNISKADLGKTLRRFKGVVWDQ
SPIFKMIYEQEYGQFGGEPFGCLIGDFYFDHSMQDVSILTEMSKISAAAHAPFIAAAAPGLLQMDDWSEL
SNPRDVSKIFTATEYAFWRRLRESNDSRYLALTLPRFLARVPYGPKTQPVEEFGFEEKVDPNRAEDFCWA
NSAYAMGANITRAFKTYGWCTKIRGVESGGAVEVLPKFVLPSQDREVDLHCPTEIAISDRREHELSESGL
MPLVYRKNSDTAAFIGAKTVHRPAIYEDDDATANSNLSSRLPYIFATCRFAHYLKCIVRDKIGSFKSAED
TQRWLNDWLMNYVDGDPSISSEVTKSQRPLSAAEVVVDEIPENPGYYRAQFFLRPHFQLEGLTVSLRLVS
KLPSTKHEVTT
 
Nucleotide Sequence: 1506 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c762998-761493 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGCAGCAGCTTGAATCGTCTGCCGAGAAGGTGGTCGTCGATCAGAACAACGTCAACGAGGATCTGAAGG
ACATCCTGCGCCGCTCGTTCCGGCCGCGCACCAACGAGGCGGCCGAGGCGGTGCAGAACGCGGTCGAGAC
GCTGCTCACGTATGCGCGGCGCAGCCGGGTCGTGGTTCGTGAGGATGTCGCGCAGACGATCGAGCAGCTG
GTTGCCGAGCTCGACAAGAAGATCTCCGAGCAACTGACGCTCGTGCTGCACAACAAGCGCTTTCAGAGCC
TCGAAGGCGCGTGGCGCGGATTGCACTACCTCGTGTCGAACACCGATACGAGCGAGAACCTGAAGATCCG
CTACCTGAACATCTCGAAAGCGGATCTCGGCAAGACGCTGCGGCGCTTCAAGGGCGTCGTGTGGGATCAG
AGTCCGATTTTCAAGATGATCTACGAGCAGGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCTGCCTGA
TCGGCGACTTCTATTTCGACCACAGCATGCAGGACGTGTCGATCCTCACCGAGATGTCGAAGATCTCGGC
GGCCGCTCACGCGCCGTTCATCGCGGCTGCCGCGCCCGGCCTGCTGCAGATGGACGACTGGAGCGAGCTG
TCGAACCCGCGCGACGTGTCGAAGATCTTCACGGCGACCGAGTATGCGTTCTGGCGGCGCCTGCGCGAGA
GCAACGACTCGCGCTACCTCGCGCTCACGCTGCCGCGCTTCCTCGCGCGTGTGCCGTATGGTCCGAAGAC
GCAGCCCGTCGAAGAGTTCGGCTTCGAGGAGAAGGTCGATCCGAACCGCGCGGAGGATTTCTGCTGGGCG
AACTCCGCGTATGCGATGGGCGCGAACATCACGCGCGCGTTCAAGACCTACGGCTGGTGCACGAAGATTC
GCGGCGTCGAGTCGGGCGGCGCGGTCGAGGTGCTGCCGAAGTTCGTGCTGCCGTCGCAGGATCGCGAAGT
CGATCTGCATTGCCCGACCGAGATCGCGATCTCGGACCGCCGCGAGCACGAATTGTCCGAGTCGGGCCTG
ATGCCGCTCGTGTATCGGAAGAATTCGGATACGGCCGCGTTCATCGGCGCGAAGACCGTGCATCGTCCGG
CGATCTACGAGGACGACGACGCGACCGCGAACTCGAACCTGTCGTCGCGGCTGCCGTACATCTTCGCGAC
CTGCCGTTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGTCGGCCGAGGAC
ACGCAGCGCTGGCTCAACGACTGGCTGATGAACTACGTGGACGGCGACCCGAGCATCTCGAGCGAGGTGA
CGAAGTCGCAGCGTCCGCTGTCGGCGGCGGAGGTGGTCGTCGACGAGATTCCGGAAAACCCCGGCTACTA
TCGCGCGCAGTTCTTCCTGCGCCCCCATTTCCAACTGGAGGGTTTGACCGTTTCTCTCCGGCTGGTTTCG
AAGCTTCCGTCGACCAAGCACGAGGTGACGACCTGA
 Primer design