SecReT6
Protein ID: 121596930
SecReT6 ID165
T6SS typei1
Gene symbol-
Locus tagBMASAVP1_0623
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]636629..638053 [+]
Producthypothetical protein
NoteBMAA0729 (e)
UniProt IDA1UW77
KEGG IDbmv:BMASAVP1_0623
PDB IDNA
Domain hit(s) vs Pfam Big_5 [PF13205], Evalue: 1.30E-10, Aligned region: 140..140
Big_5 [PF13205], Evalue: 1.30E-10, Aligned region: 176..275
UCH [PF00443], Evalue: 8.60E-08, Aligned region: 282..314
UCH [PF00443], Evalue: 8.60E-08, Aligned region: 423..455
Protein Sequence: 474 a.a.     [Download]
>gi|121596930|ref|YP_990230.1| hypothetical protein BMASAVP1_0623 [Burkholderia mallei SAVP1]
MNARRPAFGLIASHASRRRAVESVRAHFPFMFTLCLAMKHTSNHSDPSGAPSSARRAASDSSRLVRGMRS
PQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNSPVAPAPTAHVSSGHTPPATAPAAM
PTASPTATPTASPTATAAASPSAPSTATPNAPPAAPPAVVATRVPPTHAALRRPTIELEFDRAIEPGSVP
HIVLRADDGTSVAVGPLSWLSDRRIAFAPRKPLKSNSRYEIMVPAGIRSTTGERSAHPLTSSFDTAPVTP
PRGLPNLDGASCFINTALQLAVHSSALDDILSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALRATP
EVPDSGPGQTLEVMQALRMPLYDTSSANNATNNADAIRHAPPNTKAFFLNSYPPLSYADLPNHDRLVAFD
YSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVSIEIAIYR
 
Nucleotide Sequence: 1425 bp     [Download]
>gi|121596444|ref|NC_008784.1|:636629-638053 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGAACGCTCGACGTCCGGCGTTCGGCCTGATTGCGTCGCACGCGTCACGCCGCCGGGCCGTCGAATCCG
TGCGCGCCCACTTTCCGTTCATGTTCACCCTCTGTCTTGCGATGAAACACACTTCGAACCACTCCGACCC
TTCCGGTGCGCCGTCGTCAGCGCGACGCGCCGCATCCGATTCGTCCCGCCTCGTCCGCGGCATGCGCTCG
CCCCAACGCGGCGGCGCGGCACTGGCGCTGGCCGTCGCCTCGCTCGCCGGATGCGGGGGCGGCGATTCGG
GCGAACCCGCTCCACGCGAATTCGCGCCCCCGACAGTGCAACTCGCCTACCCGACGCAACCGAACTCGCC
CGTCGCACCAGCGCCCACCGCGCACGTATCGAGCGGACACACGCCTCCGGCCACGGCGCCCGCCGCGATG
CCCACCGCTTCACCCACCGCGACGCCTACCGCTTCACCCACCGCGACGGCTGCCGCTTCGCCCTCCGCGC
CATCCACTGCGACGCCCAACGCCCCGCCCGCCGCTCCGCCGGCCGTCGTCGCCACCCGCGTCCCGCCGAC
GCACGCGGCGTTGCGCCGCCCGACGATCGAACTCGAATTCGATCGCGCGATCGAGCCGGGTTCAGTCCCA
CACATCGTGCTGCGCGCCGACGATGGCACGAGCGTCGCCGTCGGCCCGTTGTCGTGGCTGAGCGATCGCC
GGATCGCGTTCGCGCCGCGCAAACCGCTCAAGTCGAACAGCCGCTACGAAATCATGGTGCCCGCCGGCAT
CAGGAGCACCACGGGCGAACGGTCGGCCCATCCGCTAACGAGCAGCTTCGATACCGCGCCCGTTACGCCG
CCGCGCGGCCTGCCCAATCTCGACGGCGCCTCGTGCTTCATCAACACGGCGCTGCAATTGGCGGTTCACT
CGTCGGCGCTCGACGACATTCTGTCGAACGAAGCCGTCCCGCCCGCCGTCCGCACGCTGCTCGAAGACTA
CGACGCCGCATCGGCTGATGCACTCGACGCGCAGTTGGCCGCCGCGGTCGCCGCGCTGCGCGCCACGCCG
GAGGTCCCGGACAGCGGGCCGGGACAAACGCTGGAAGTGATGCAAGCGTTGCGGATGCCGTTATATGACA
CGAGCAGCGCGAACAACGCAACGAACAACGCCGACGCCATACGTCATGCGCCGCCCAACACCAAGGCGTT
CTTTCTGAACTCCTATCCACCGCTTTCCTACGCGGATCTGCCGAACCACGACCGGCTCGTCGCGTTCGAC
TACAGCACGGGCGGTCACTATGTCGCTTATGTGAAGCGGGATGGAATCTGGTATCGAATCGACGATGCCC
AGGTCAGCGCCGTCAACGAACAGGACTTGCTTGCCCTGCCGGCGTTCAACCCCGCTAACGGCAGCGTGTC
GATCGAAATCGCGATCTATCGATGA
 Primer design