SecReT6
Protein ID: 121597055
SecReT6 ID165
T6SS typei1
Gene symbol-
Locus tagBMASAVP1_0603
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]609983..611827 [-]
Productsensor histidine kinase
NoteVirA
UniProt IDA1UW58
KEGG IDbmv:BMASAVP1_0603
PDB IDNA
Domain hit(s) vs Pfam HATPase_c [PF02518], Evalue: 7.60E-21, Aligned region: 454..592
MASE1 [PF05231], Evalue: 2.10E-15, Aligned region: 62..323
HisKA [PF00512], Evalue: 0.00055, Aligned region: 311..338
HisKA [PF00512], Evalue: 0.00055, Aligned region: 337..402
Protein Sequence: 614 a.a.     [Download]
>gi|121597055|ref|YP_990211.1| sensor histidine kinase [Burkholderia mallei SAVP1]
MHGNSIDAGPPARARPARITRTARTAPRRDDRAFAPGGALNAAGLLLLLFYANHLLSRPGACTSLNHTLS
AVVWPAPVLGIALLLHCRRPLAWWLGAGSLFATLLAAGSLDWVPWHVDALFAAVNVVEAIAGAWLARRYL
IAGGGVDTLRGFAMFVLLLPLGMAAMHATLAAAILSVWMNDREWLSEWSRAYAANALALLVLLPALLTWN
ARACGAAWSRSRNQLPVLATFGSLCFASIWGYQAEVARALLALSLSWAALEGGLVLASQLNALSAIALIA
MTLGGRGPYAWHHDGHGVWALQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLGFFAGGIVHDFS
NVLTTIDCHAEYASERLASGARADDSIDEIHRAVERGRDLAAQILLAARRGEPVLTRVSVDEVVDEALAA
TRAAAWRGVEIVRCGDGARDGARRGDVRHVVFADRSQLARAVMNLVGNAVRAARATVVVRVGVNGGVNGG
ASDGASRGANDGGAPAARAFDVAIGEAAMPGGVWIEVSDDGEGIDVEPLDRIFEPFYSNRSGAPGTGLGL
AIVAGAALAHRGQIAVATDRGAGSCFRLTLPAAWGTGAPGAMDAGAPGAVQERT
 
Nucleotide Sequence: 1845 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c611827-609983 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGCACGGAAATTCCATCGATGCCGGGCCGCCCGCGCGCGCCCGGCCCGCACGCATCACGCGAACGGCGC
GCACCGCGCCGCGCCGCGACGATCGCGCGTTCGCGCCGGGCGGCGCGCTGAACGCGGCGGGGCTGCTGCT
GCTGCTGTTCTACGCGAATCATCTGCTGTCCCGGCCCGGCGCGTGCACGTCGCTCAATCACACGCTGTCG
GCCGTCGTGTGGCCCGCGCCGGTGCTCGGCATCGCGCTGCTGCTGCACTGCCGGCGGCCGCTCGCATGGT
GGCTCGGCGCGGGTTCGCTGTTCGCCACGCTGCTCGCCGCGGGCTCGCTCGACTGGGTGCCGTGGCACGT
CGACGCGCTGTTCGCGGCCGTCAACGTCGTCGAGGCGATCGCGGGCGCGTGGCTCGCGCGGCGCTATCTG
ATCGCGGGCGGCGGGGTGGACACGCTGCGCGGCTTCGCGATGTTCGTGCTGCTGCTGCCGCTCGGCATGG
CGGCGATGCACGCGACGCTCGCGGCGGCGATCCTGTCGGTATGGATGAACGACCGCGAATGGCTGAGCGA
ATGGTCGCGCGCGTATGCGGCGAACGCGCTCGCGCTGCTCGTGCTGCTGCCGGCGCTCCTCACGTGGAAC
GCGCGCGCATGCGGCGCGGCGTGGTCGCGCAGCCGCAATCAGTTGCCGGTGCTCGCGACGTTCGGCTCGC
TGTGCTTCGCGTCGATATGGGGATACCAGGCCGAGGTCGCGCGCGCGCTGCTCGCGCTGTCGCTGAGCTG
GGCCGCGCTCGAGGGCGGCCTCGTGCTCGCGTCCCAGCTCAACGCGCTCTCGGCGATCGCCCTGATCGCG
ATGACGCTCGGCGGGCGCGGCCCGTATGCGTGGCATCACGACGGCCACGGCGTCTGGGCGCTGCAGGTCG
ATCTGATCGGCGTCGCGATCCTGTCGATGTGCATCGCGATCGCGACGGGCGAGCGGCGGCGGCTTGCGCG
GCAGATCGAACGATCGCGCCGTTTCGAGTCGCTCGGCTTTTTCGCCGGCGGAATCGTGCACGATTTCAGC
AACGTGCTGACGACGATCGATTGCCACGCCGAATACGCGTCCGAGCGGCTCGCGAGCGGCGCGCGCGCGG
ACGATTCGATCGACGAGATTCATCGCGCGGTCGAACGCGGCCGCGATCTGGCGGCGCAGATCCTGCTCGC
CGCGCGCCGCGGCGAGCCCGTGCTGACGCGGGTGAGCGTCGACGAGGTCGTCGACGAGGCGCTCGCCGCG
ACACGCGCGGCCGCGTGGCGCGGCGTCGAGATCGTTCGATGCGGCGATGGCGCGCGCGACGGCGCCCGGC
GTGGCGACGTTCGTCACGTCGTATTCGCCGATCGCAGCCAGCTCGCGCGCGCGGTCATGAATCTCGTCGG
CAATGCGGTGCGCGCGGCGCGCGCGACGGTTGTCGTGCGTGTCGGGGTGAACGGCGGGGTGAATGGCGGC
GCGAGCGATGGGGCGAGCCGCGGCGCGAACGACGGCGGCGCGCCGGCCGCTCGCGCATTCGACGTCGCGA
TCGGCGAAGCGGCGATGCCGGGCGGCGTGTGGATCGAGGTGAGCGACGACGGCGAAGGCATCGACGTCGA
GCCGCTCGACCGCATCTTCGAGCCGTTCTATTCGAACCGCTCCGGCGCGCCGGGGACGGGGCTGGGTCTC
GCGATCGTCGCGGGCGCGGCGCTCGCGCACCGCGGGCAGATCGCCGTCGCGACGGATCGGGGCGCGGGCA
GTTGCTTCCGGCTCACGTTGCCGGCGGCATGGGGAACGGGCGCGCCCGGCGCAATGGACGCCGGCGCGCC
CGGCGCAGTACAGGAGAGGACATGA
 Primer design