SecReT6
Protein ID: 121597230
SecReT6 ID167
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_0928
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]940924..943596 [+]
ProductSciS protein
NoteTssM
UniProt IDA1UX24
KEGG IDbmv:BMASAVP1_0928
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.80E-93, Aligned region: 313..585
IcmF-related [PF06761], Evalue: 4.40E-76, Aligned region: 632..884
Protein Sequence: 890 a.a.     [Download]
>gi|121597230|ref|YP_990527.1| SciS protein [Burkholderia mallei SAVP1]
MNKFLSFLVSRSFIAFVALLAVALVIWFVGSFVAFGGLTPLAGAGMRVLAIALLLAGVLLWLAGRPTSIV
FVALLCVLIWHASPLLAFGGATPFAAEAVRAIAIALVLAAFALHLAFRLLQKARTDPDFLKSLLEFGGKQ
PESPAAGRLAAVNAAIAGAIARLKGMRSGARGLRRLLRGKRYLYELPWYVTLGSRACGKTSALLNAGLSF
PVAAQMPRAAAGLPDHGGSVDWWLTNDAVLIDTAGHYTRHGTSAHAAPLPPAGPAPHAQPADAAADARRA
NGQPAGERHAVAMAAAAPSSAAFVDERQAQWRQTVDQAEWLGFLRTLRKHRPREPINGALLAVDVATLTS
ADDNARHAEAAALRARLADLRAQLGVRFPVYLIVTKTDQLPGFAEYFSALTTEGRAQTWGFTLPYDKETI
ADEGVHARCADELRALAARLAAGVNTRLQEEHDTQRRRRLAALPEEFLVLTRPLGELIDRVFADSRYDDT
QHHATLRGVYFTSAAQTGGEAAAETRTVARRLAAATGRAPAAAARAAQQETSQSFFLHDLLTKIVIPDAR
LVQPNLRWEYRSRTLSLAAHALALLLFAWVAIGLRVSMGNNDAYLDALARKTAALASRVDQLYKAPKPEA
VPDVLTQARSLSAYPGLDLSAAGSGWRFGLYTPPGIVAESSRTYDALEDTLLLPRIVTRIEAVLSQAIAD
RDPKAAYDALRVYLMLYDRARFDAAQVEAWVLDDWARTDSAAVFGGRASMIAHVEQLFRGERIVQSPLIR
NDALIRQARAFLDGSNATERLYERAKAAMNKEAPDEFTLLRAVGPQAGTVFTRASGAPLARGVPGLFTFD
GYRRVFDKRLAEFVRTAREDDAWVMGRAYLGDAQKKRLRSRMRSRGPTIR
 
Nucleotide Sequence: 2673 bp     [Download]
>gi|121596444|ref|NC_008784.1|:940924-943596 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGAACAAGTTCCTGTCCTTTCTGGTGTCTCGATCGTTCATCGCGTTCGTCGCGCTGCTCGCCGTCGCGC
TCGTCATCTGGTTCGTCGGCTCGTTCGTCGCGTTCGGCGGGCTCACGCCGCTCGCGGGCGCGGGCATGCG
CGTCCTCGCGATCGCGCTGCTGCTGGCGGGCGTGCTGCTGTGGCTCGCGGGCCGGCCGACGAGCATCGTG
TTCGTCGCGCTGCTGTGCGTGCTGATCTGGCATGCGTCGCCGCTGCTCGCGTTCGGCGGCGCGACGCCGT
TCGCGGCGGAGGCGGTCCGGGCGATCGCGATCGCGCTCGTGCTCGCGGCGTTCGCGCTGCACCTTGCGTT
CCGGCTGCTGCAAAAGGCGCGCACCGATCCGGATTTTCTGAAGAGCTTGCTCGAATTCGGCGGCAAGCAG
CCCGAATCGCCCGCGGCCGGCCGCCTGGCGGCGGTCAACGCCGCGATCGCCGGCGCGATCGCGCGCCTGA
AAGGCATGCGCAGCGGCGCGCGCGGCCTGCGCCGCCTGTTGCGCGGCAAGCGCTATCTGTACGAACTGCC
GTGGTACGTCACGCTCGGCTCGCGGGCATGCGGCAAGACGAGCGCGCTCCTGAACGCCGGGCTCTCGTTT
CCGGTCGCGGCGCAAATGCCGCGCGCGGCAGCCGGGCTGCCGGATCACGGCGGCTCGGTCGACTGGTGGT
TGACCAACGATGCGGTGCTGATCGACACGGCCGGCCATTACACGCGTCACGGCACGTCGGCGCACGCGGC
GCCGCTGCCGCCCGCCGGGCCCGCGCCGCACGCCCAGCCCGCCGACGCGGCCGCCGACGCGCGCCGCGCG
AACGGTCAGCCGGCGGGCGAGCGGCACGCCGTCGCGATGGCCGCGGCGGCGCCGTCGAGCGCCGCGTTCG
TCGACGAGCGGCAGGCGCAATGGCGGCAGACCGTCGACCAGGCCGAATGGCTGGGCTTTCTGCGGACGCT
GCGCAAGCATCGGCCGCGCGAGCCGATCAACGGCGCGCTGCTCGCCGTCGACGTCGCCACGCTCACGAGC
GCCGACGACAATGCGCGCCATGCCGAGGCAGCCGCGCTGCGCGCGCGGCTCGCCGATCTGCGCGCGCAAC
TGGGCGTGCGCTTTCCCGTCTATCTGATCGTCACGAAGACGGACCAGTTGCCGGGCTTCGCCGAATACTT
CAGCGCGCTGACCACGGAGGGCCGCGCGCAGACGTGGGGGTTCACGCTGCCGTACGACAAGGAGACCATC
GCGGACGAAGGCGTCCACGCGCGCTGCGCCGACGAGCTGCGCGCGTTGGCCGCGCGGCTCGCCGCGGGCG
TGAACACCCGCCTGCAGGAAGAGCACGACACGCAGCGGCGCCGCCGGCTCGCCGCGCTGCCGGAGGAATT
TCTCGTGCTGACACGCCCGCTCGGCGAGCTGATCGATCGCGTCTTCGCCGATTCCCGCTACGACGACACG
CAGCATCACGCGACGCTGCGCGGCGTGTATTTCACGAGCGCCGCGCAGACGGGCGGCGAGGCCGCCGCCG
AAACGCGCACCGTCGCGCGACGCCTCGCCGCCGCGACGGGCCGCGCGCCGGCCGCGGCCGCGCGCGCGGC
GCAGCAGGAAACCAGCCAGAGCTTCTTCCTGCACGATCTGCTGACGAAGATCGTCATTCCGGACGCACGC
CTCGTCCAGCCGAACCTTCGCTGGGAGTATCGCTCGCGCACGCTGAGCCTCGCCGCTCACGCGCTCGCGC
TGCTGCTGTTCGCGTGGGTCGCGATCGGCCTGCGCGTCAGCATGGGCAACAACGATGCCTATCTCGACGC
GCTCGCGCGCAAGACGGCGGCGCTCGCCTCCCGGGTCGACCAGTTGTACAAGGCGCCGAAGCCCGAGGCC
GTGCCCGACGTGCTGACGCAAGCCCGCTCGCTGAGCGCGTACCCGGGCCTCGATCTGTCCGCGGCGGGCA
GCGGCTGGCGGTTCGGCCTGTACACGCCGCCCGGCATCGTCGCCGAAAGCAGCCGCACGTACGACGCGCT
CGAGGACACCCTGCTGCTGCCGCGGATCGTCACGCGCATCGAGGCGGTGCTGTCGCAGGCGATCGCCGAT
CGCGATCCGAAGGCCGCGTACGACGCGCTGCGCGTCTATCTGATGCTGTACGACCGGGCCCGCTTCGATG
CCGCGCAGGTCGAGGCGTGGGTGCTCGACGACTGGGCGCGAACCGACAGCGCGGCGGTCTTCGGCGGCCG
CGCGTCGATGATCGCGCACGTCGAGCAACTGTTCCGCGGCGAGCGCATCGTGCAATCCCCGCTGATCCGC
AACGATGCGCTGATCCGCCAGGCGCGCGCGTTCCTGGACGGCAGCAACGCGACCGAGCGGCTCTACGAGC
GCGCGAAGGCGGCGATGAATAAAGAAGCGCCCGACGAGTTCACGCTGCTGCGGGCCGTCGGCCCGCAGGC
CGGCACGGTGTTCACGCGCGCGAGCGGCGCGCCGCTCGCGCGGGGCGTGCCGGGCCTCTTCACGTTCGAC
GGATACCGGCGCGTGTTCGACAAGCGGCTCGCCGAATTCGTGCGGACCGCGCGCGAAGACGATGCATGGG
TGATGGGCCGCGCGTATCTCGGCGACGCTCAAAAAAAACGGCTGAGATCGCGAATGCGCTCGCGGGGGCC
GACGATCCGCTGA
 Primer design