SecReT6
Protein ID: 121597348
SecReT6 ID166
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_0733
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]743487..744095 [-]
Producthypothetical protein
NoteTssK
UniProt IDA1UWI5
KEGG IDbmv:BMASAVP1_0733
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.20E-57, Aligned region: 2..197
Protein Sequence: 202 a.a.     [Download]
>gi|121597348|ref|YP_990338.1| hypothetical protein BMASAVP1_0733 [Burkholderia mallei SAVP1]
MRLANLDAFDPLPPAMLYHELVGLLGRLSVLPGVDEELADRELGYDHDDLQTSFEPLAMMLRQALARVIE
TPVLPLRFEDRGDQVHICIVDKQWNLKKLIFAFSAAMPAEKLRQLLPQQTKLGAVEQIQKLVDLQLPGAR
LNALPNPPRQIPYYAQSTYFEVESTDPFWKQTLAGSAMALRIVGDFPDLRFEAWGLRDGKVA
 
Nucleotide Sequence: 609 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c744095-743487 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGCGCTTGGCGAACCTCGACGCGTTCGATCCGCTGCCGCCGGCGATGCTGTATCACGAGCTGGTCGGCC
TGCTCGGGCGGCTGAGCGTGCTGCCGGGCGTCGACGAGGAGCTGGCCGACCGCGAGCTCGGCTACGACCA
CGACGATCTGCAGACGAGCTTCGAGCCGCTCGCGATGATGCTGCGCCAGGCGCTCGCGCGCGTGATCGAG
ACGCCGGTGCTGCCGCTGCGCTTCGAGGATCGCGGCGATCAGGTGCACATCTGCATCGTCGACAAGCAGT
GGAACCTGAAGAAACTGATTTTTGCGTTTTCGGCCGCGATGCCGGCGGAGAAGCTGCGGCAACTGTTGCC
GCAGCAGACGAAGCTGGGCGCCGTCGAGCAGATCCAGAAGCTCGTGGACCTGCAACTGCCGGGCGCGCGG
CTGAACGCGCTGCCCAATCCCCCGCGCCAGATTCCCTACTACGCCCAAAGCACGTACTTCGAAGTGGAAT
CGACCGATCCGTTCTGGAAGCAGACCCTCGCCGGCTCGGCGATGGCGCTGCGCATCGTCGGCGATTTCCC
CGATCTTCGCTTCGAAGCCTGGGGGCTGAGAGACGGCAAGGTGGCGTGA
 Primer design

Protein ID: 121596645
SecReT6 ID166
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_0734
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]744114..745259 [-]
Producthypothetical protein
NoteTssK
UniProt IDA1UWI6
KEGG IDbmv:BMASAVP1_0734
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-53, Aligned region: 158..380
Protein Sequence: 381 a.a.     [Download]
>gi|121596645|ref|YP_990339.1| hypothetical protein BMASAVP1_0734 [Burkholderia mallei SAVP1]
MRVCRDRGRLAADAGRRRFVVRVARAGQHGRRRLAARDRAEPVAAVLAEPAALGRALARRRRRLRAPAGE
LRAAARARRGPRLDSHGCLAGPRRHLQRVVAGARARRRRDRPGGGPPRRAAARAQDENHLWDKEKQAMSS
LPVGPVAWSDGMLIETQHFQQLERHLAHQASLRLGQTSNHGWGFTLLDLDQDGLGLGRLGLRHARGVFQD
GTAFSLPSDDPLPPPLETELAQAGDIACLALQAARTGGPEMAFGDVELASRYRAVSTEVPDLAVGLDAPG
TPRRLTIETGQLVTRLCWKSQLRSDEVALPIARVAGRNASRTVSLDPRFIPPLLDTRAHLVLRSLIDELQ
STLRVRLASTSAQRVLSTGGGVADLIELLLR
 
Nucleotide Sequence: 1146 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c745259-744114 Burkholderia mallei SAVP1 chromosome II, complete sequence
GTGCGTGTATGTCGTGACCGCGGCCGACTGGCTGCCGACGCAGGGCGGCGACGATTCGTCGTGCGCGTCG
CGCGGGCAGGACAGCACGGTCGTCGCCGACTCGCGGCACGTGATCGCGCCGAACCAGTTGCTGCAGTTCT
CGCTGAACCTGCCGCGCTCGGGCGAGCTCTGGCTCGTCGCCGACGCCGACTACGCGCGCCGGCCGGCGAA
CTACGGGCCGCTGCGCGTGCGCGTCGAGGGCCGCGGCTTGATTCACATGGCTGTCTGGCTGGACCGCGAC
GGCATCTACAACGCGTTGTTGCCGGGGCCCGTGCCCGTCGGCGGCGCGATCGCCCCGGCGGCGGTCCGCC
CCGACGAGCCGCCGCCCGAGCGCAAGACGAAAACCACCTATGGGACAAGGAGAAGCAGGCAATGAGTAGT
CTGCCGGTAGGACCGGTCGCGTGGAGCGACGGCATGCTGATCGAGACGCAGCACTTCCAGCAGCTCGAGC
GGCATCTCGCGCATCAGGCCTCGCTGCGGCTCGGTCAGACGTCGAATCACGGCTGGGGCTTCACGCTGCT
CGATCTCGACCAGGACGGCCTGGGGCTCGGCCGGCTCGGGCTGCGCCACGCGCGCGGCGTGTTCCAGGAC
GGCACCGCGTTCTCGCTGCCGTCGGACGATCCGCTGCCGCCGCCGCTGGAAACCGAGCTCGCGCAGGCGG
GCGACATCGCGTGCCTCGCGCTGCAAGCCGCGCGCACGGGCGGCCCGGAGATGGCGTTCGGCGACGTCGA
GCTGGCGTCGCGCTATCGCGCGGTGTCGACCGAGGTGCCGGATCTCGCGGTCGGGCTCGACGCGCCCGGC
ACGCCGCGGCGCCTGACGATCGAGACGGGCCAGCTCGTCACGCGCCTGTGCTGGAAGTCGCAGCTGCGCT
CGGACGAGGTCGCGCTGCCGATCGCGCGCGTGGCGGGGCGCAACGCGAGCCGCACGGTGTCGCTGGATCC
GCGCTTCATTCCGCCGCTGCTCGACACGCGCGCGCACCTGGTGCTGCGCTCGCTGATCGACGAGCTGCAG
AGCACGCTGCGCGTGCGGCTCGCGAGCACGTCCGCGCAGCGCGTGCTGTCGACGGGCGGGGGCGTGGCCG
ATCTGATCGAGCTGCTGCTGCGCTAG
 Primer design