SecReT6
Protein ID: 121597383
SecReT6 ID166
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_0741
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]752339..754585 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA1UWJ3
KEGG IDbmv:BMASAVP1_0741
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.30E-70, Aligned region: 23..328
Phage_GPD [PF05954], Evalue: 4.30E-70, Aligned region: 677..705
Phage_base_V [PF04717], Evalue: 3.40E-23, Aligned region: 366..459
Protein Sequence: 748 a.a.     [Download]
>gi|121597383|ref|YP_990346.1| Rhs element Vgr protein [Burkholderia mallei SAVP1]
MRLIELRSPLLDPDAVALSFVVHESLSQEPSYQLDLLSHDPDLDFDALFGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQNMSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSNKLDSDAQQVSPPNLEGIPLEYYDYAAGYREPEQGERLARLRLEA
IQAESHTLVGEANARALATGRAFTLIGHPALGRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADD
QPFRPLLTTPRPEVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVSQAWAGKGWG
VIAMPRVGQEVLVTYVDGDLDRPLVTGIVYNGENPTPYDLPKDIRYTGLVSRSIKRAGGYQNASQITFDD
QRGAERVMIHAERDMQQTVERNSSTSVVGISISFTGISVSYTGLSVSFTGVSASFTGVSTSFTGVSTSFT
GVSTSFTGVDTGFKGVSTSFTGVDTSFKGVSTSFTGVSTSLTGSSNSVTGVSNSMTGISSSWTDVSMSTT
GQSQSITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTTGSSTSVTGSSVSTT
DSSVSTTGSSVSTTGSSVSTTGFSFSYTGVSYSDTGIDLKKVGMQVKS
 
Nucleotide Sequence: 2247 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c754585-752339 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGATGCGGTGGCGCTGAGCTTCGTGGTGCACG
AGAGCTTGTCGCAGGAGCCGTCGTATCAACTGGATCTGCTGAGCCACGACCCGGATCTGGACTTCGACGC
GCTGTTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGC
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGAACATGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGTACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGATCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATCTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAACAAGCTCGACAGCGACGCGCAGCAGGTGTCGCCGCCGAACCTCGAGGGGATTCCGCTCGAGTA
TTACGACTATGCGGCGGGCTACCGCGAGCCCGAGCAGGGCGAGCGTCTCGCGCGGCTGCGGCTCGAGGCG
ATTCAGGCGGAATCACACACGCTGGTGGGCGAGGCGAACGCGCGCGCGCTGGCCACGGGCCGGGCGTTCA
CGTTGATCGGGCATCCGGCGCTGGGGCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCAT
CCAGGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTTGCCGACGAT
CAGCCGTTTCGGCCGCTGTTGACGACGCCGCGTCCCGAAGTGCCGGGTATCCAGAGCGCGACGGTGGTGG
GTCCGGAGATGTCGGAAGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCATTTCCATTGGGACCGCTA
CAAGACGACCGAGGCGGATGCGTCGTGCTGGATACGCGTGTCGCAGGCATGGGCGGGCAAGGGCTGGGGC
GTGATCGCGATGCCGCGGGTCGGGCAGGAAGTGCTCGTCACGTATGTCGACGGCGATCTCGATCGGCCGC
TCGTGACGGGCATCGTCTACAACGGCGAGAACCCGACGCCTTATGACTTGCCGAAGGACATCCGCTACAC
GGGGCTGGTGTCGCGTTCGATCAAGCGTGCGGGCGGTTATCAGAACGCGAGTCAGATCACGTTCGATGAC
CAGCGCGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACATGCAGCAGACGGTCGAGCGCAACAGCT
CGACGTCGGTCGTCGGCATCTCGATTAGCTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAG
CTTCACCGGCGTGTCGGCGAGCTTCACGGGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACC
GGCGTGTCGACGTCGTTTACCGGCGTCGACACCGGCTTCAAGGGCGTGTCGACGTCGTTTACCGGTGTCG
ATACCAGCTTCAAGGGTGTGTCGACTTCGTTCACGGGCGTAAGCACGAGCCTCACCGGTTCGAGCAACTC
GGTGACGGGCGTATCGAACAGCATGACGGGCATCTCGTCATCATGGACCGACGTCAGCATGTCGACGACC
GGCCAATCCCAAAGCATCACGGGGGTATCGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGA
GCACGTCGGTGACGGGCACCTCGACGAGCATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAG
CATCACGGGCACGTCGATGTCGACGACGGGCAGCTCGACGAGCGTCACCGGCTCGAGCGTATCGACGACC
GACAGCTCGGTGAGCACGACGGGCTCGAGCGTGTCGACAACGGGCAGCAGCGTGTCGACGACGGGTTTCA
GCTTCTCGTACACCGGCGTCAGCTATTCGGACACCGGTATCGACCTGAAGAAGGTCGGCATGCAAGTGAA
GAGCTGA
 Primer design