SecReT6
Protein ID: 121597385
SecReT6 ID165
T6SS typei1
Gene symbol-
Locus tagBMASAVP1_0617
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]629938..631371 [+]
Producthypothetical protein
NoteTssK
UniProt IDA1UW72
KEGG IDbmv:BMASAVP1_0617
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-98, Aligned region: 28..474
Protein Sequence: 477 a.a.     [Download]
>gi|121597385|ref|YP_990225.1| hypothetical protein BMASAVP1_0617 [Burkholderia mallei SAVP1]
MTHDASRTGTNDMDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVE
IRSARLLFADRSYVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDALPDAPTRY
ATLPSAEEVADLHSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVRDGERLRLDDDFAPPCYAL
SGSRTLLERVRCIRDELAGRARQLQQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHP
WTVYGVLRQLVGELSVFSECFDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATF
EPDGPQQPAQRSAQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTR
LPGPPPRLPRRGDARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|121596444|ref|NC_008784.1|:629938-631371 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGACGCACGACGCATCACGAACCGGAACGAACGACATGGACAACGTCTATTGGCATCAGGGGATGCTGC
TGCAACCGCAACATTTTCAGTTGGCCGAACTGCACCAGCAGTTCCGCTTCGAGCCGTGGCTCGCGTGCGG
CCCGCCGCATTTCTGGGGCGTCGGCGCGCTGTCGCTCGCGCAGGCCGCGATCGATCGCCGCGTGGTCGAG
ATCCGCTCGGCGCGCCTGCTGTTCGCCGACCGCAGCTACGTCGAATATCCGGGCAACGCGGTCGTCGCCG
CGCGCGCGTTCGATCCCGCGTGGCTCGACGAAGGCCGCGCGCTCGTCGCGCACGTCGCGCTCAGGCGGCT
CGCGCGCGGCGCGAACAACGTGACGGTCGCGGCCGCGCCCGACGCGTTGCCCGACGCCCCGACGCGCTAC
GCGACGCTGCCGTCCGCCGAGGAGGTCGCCGATCTGCATTCGGACCATCCGGGCGCGCCGGTGCGCACGC
TCAAGCACGTGCTGAAGATCGTGTTCGAGCACGAGCTCGACGCGCTCGCCGCGCACGAAACGATCCCGAT
CGCGCGGATCGTGCGCGACGGCGAGCGCCTGCGGCTCGACGACGATTTCGCGCCGCCCTGCTACGCGCTG
TCGGGCTCGCGCACGCTGCTCGAGCGCGTGCGCTGCATTCGCGACGAGCTCGCGGGCCGCGCGCGGCAGT
TGCAGCAGTACAAGAATCCGCGCGAGATGCAACGCGCCGAATTCGACGCGAGCTATGCGGCGTTCCTGCT
CGCGCTGCGCTCGCTGAACCGCTTCGGCCCGCTGCTGTTCCATCTCGCCGAATGCGACGGGCAGCATCCA
TGGACGGTCTACGGCGTGCTGCGCCAACTCGTCGGCGAGCTGAGCGTGTTCTCCGAGTGCTTCGACATGC
TCGGCGAGACGCCCGATGCGCGCGGCGGCCTGCCGCCGTACGACCACCGCGATCTGGGCGGCTGCTTCTC
GCGCGCGCACGCGCTGATCGGCCACCTGCTCGACGAAATCGCGGTGGGCCCGGACTGCGTCGCGACGTTC
GAGCCCGACGGCCCGCAGCAGCCCGCGCAACGCTCGGCGCAACTGCCGCCCGACGTGTTCGCGGATCGCC
ACCAGATCTATCTCGCGATCCGCAGCGCGCACGATCCGGACACGCTCGCGCAACGCTTCGCGCTCGGCGG
CCGGATCGCGGCGACCGACGAAATGCCGCAGCTCACCGCGCTCGCGCTGCCGGGCGTCGAACTCACCCGC
CTGCCCGGCCCGCCGCCGCGGCTGCCGCGCCGCGGCGACGCGCGCTACTTCCGGATCGAGCAGGCCGGCC
GCCCGTGGGACGCGATCCGGCGTGACGGCCGCGTGTCGCTGCGCTGGGCCGACGCGCCCGACGACCTGCA
CGCGGAACTCGTCGCAGTGAGGCACACGCAATGA
 Primer design