SecReT6
Protein ID: 121597415
SecReT6 ID166
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_0750
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]763583..764521 [-]
Producthypothetical protein
NoteTssA
UniProt IDA1UWK1
KEGG IDbmv:BMASAVP1_0750
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-16, Aligned region: 46..104
Protein Sequence: 312 a.a.     [Download]
>gi|121597415|ref|YP_990354.1| hypothetical protein BMASAVP1_0750 [Burkholderia mallei SAVP1]
MNNDALPGHSPDLLDFDEDFIKIDAAICEYDSVGYAPQRKGESAFQWASIETGCLALLKKAKDVRVGIWH
LRACIARRGLSGLADGVRSLADLMSAPVEELHPRALPDESPGETLLIHLGWLAGPQFLHQLGSSRFEDRD
ATLNDLIGGRAAAIVEDRDYRLRANTLVHGIQDSLSRIRESIAAAEQELNVSRVLDLLSVAASRLTQAQA
GGADSASVESDAPVDAPAGASAPGAQQPMAGPGGVLRSRQEVGAALDRIVEYFRVHEPSHPAPIFLSRIQ
RMLGAGFEEVMAELYPEAASLVAQLSRPQSSK
 
Nucleotide Sequence: 939 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c764521-763583 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGAACAACGATGCACTCCCGGGCCATTCGCCGGATTTGCTGGATTTCGACGAAGACTTTATCAAGATCG
ACGCAGCCATCTGCGAATACGATTCCGTCGGTTACGCGCCGCAACGCAAAGGAGAGAGTGCGTTCCAGTG
GGCGTCCATCGAAACGGGATGTCTCGCTTTGTTGAAGAAGGCGAAGGATGTCCGGGTCGGCATTTGGCAT
CTGCGCGCATGCATCGCGCGGCGCGGGCTGAGCGGGCTGGCAGACGGCGTTCGATCGCTGGCCGATCTGA
TGAGTGCGCCCGTCGAGGAATTGCATCCTCGCGCGCTGCCTGACGAATCGCCCGGCGAAACCCTCCTGAT
TCATCTCGGCTGGCTTGCGGGCCCGCAGTTTCTGCATCAGCTCGGCAGTTCCCGGTTCGAAGACCGGGAC
GCAACCCTCAACGATCTGATCGGCGGGCGCGCCGCGGCGATCGTGGAGGATCGCGACTATCGCCTTAGAG
CGAATACTCTTGTACATGGCATTCAGGATTCCTTATCGCGAATTCGGGAATCGATCGCCGCGGCCGAGCA
AGAGCTCAACGTCTCGCGCGTGCTCGACCTGTTGAGCGTCGCGGCGTCTCGGCTCACGCAGGCACAAGCC
GGCGGCGCGGACAGCGCAAGCGTCGAGAGCGACGCGCCGGTCGATGCGCCGGCCGGCGCGTCCGCGCCCG
GCGCGCAGCAGCCGATGGCGGGGCCGGGCGGCGTGTTGAGGTCGAGACAGGAGGTCGGCGCGGCGCTCGA
TCGGATCGTGGAGTACTTCCGCGTGCACGAACCGAGCCATCCGGCGCCGATCTTCCTGTCGCGGATTCAA
CGAATGCTGGGGGCGGGTTTCGAGGAAGTGATGGCGGAGCTCTATCCCGAGGCGGCATCTCTCGTGGCCC
AACTGAGCCGGCCGCAGAGTTCCAAGTAA
 Primer design