SecReT6
Protein ID: 121597456
SecReT6 ID165
T6SS typei1
Gene symbol-
Locus tagBMASAVP1_0605
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]612578..614104 [+]
Producthypothetical protein
NoteTssC
UniProt IDA1UW60
KEGG IDbmv:BMASAVP1_0605
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-187, Aligned region: 81..506
Protein Sequence: 508 a.a.     [Download]
>gi|121597456|ref|YP_990213.1| hypothetical protein BMASAVP1_0605 [Burkholderia mallei SAVP1]
MNRDTEQTTMEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPK
RPIETVSQATIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTAL
FDDFEDSPDITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAG
PAFFGIDSFGKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEER
VDGGDAHFLWGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISER
REFELAEQGFIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKV
IQRENIGSWKERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHF
KYMGAFFTLSLVGKLEKR
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|121596444|ref|NC_008784.1|:612578-614104 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGAACCGCGACACGGAACAGACGACCATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGC
CGGACGCGACGCCGCCCGAGTCCCCCGCCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCG
CGACGAAGACGCATACCCGATCACGCGCCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAG
CGCCCGATCGAGACCGTGAGCCAGGCGACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCC
GGCAGATCGACGCGATCCTCCATGACCCGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTT
TCTCGTCGATCGAACGGATTTCCGCGAGAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAACGGCGCTG
TTCGACGACTTCGAGGATTCGCCCGACATCACGAAATCCGGGCTGTACCAGAAGGTCTATACGGCCGAGT
ACGGCCAATTCGGCGGCCAGCCGATCGGCGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGA
CGTCAAGCTGCTGCAGTACGTCGCGAGCACGTCGGCGATGGCGCATACGCCGTTCATCGCGGCGGCGGGC
CCCGCGTTCTTCGGCATCGATTCGTTCGGCAAGCTGCCGAACGTGAAGGATCTCGCCTCGCTGTTCGAGG
GGCCGCAATACGCGAAATGGAATGCGTTTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCC
GCGCTTCTTGCTGCGGCTGCCTTACGGCGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGC
GTCGACGGCGGCGACGCGCATTTTCTGTGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGA
GCTTCGCCGACTATCGCTGGTGCGCGAACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCC
GCTCTACGCGTACGAATCGATGGGCGAGATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGC
CGCGAGTTCGAGCTCGCCGAACAGGGCTTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCCGCCT
TTTTCTCCGCGAACTCCACGCAGAAGCCGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGAGGCCGAGCT
CAACTATCGGCTCAGCACGCAACTGCCGTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTG
ATCCAGCGGGAAAACATCGGCTCGTGGAAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCC
GCCAGTACGTCGTCGACATGGACAACCCGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCA
GATCGTCGTGTCGGACGTCGAGGGCGAACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTC
AAGTACATGGGCGCGTTCTTCACGCTGTCGCTCGTCGGCAAGCTCGAAAAGCGCTAG
 Primer design