SecReT6
Protein ID: 121597609
SecReT6 ID166
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_0735
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]744845..745438 [-]
Productlipoprotein
NoteTssJ
UniProt IDA1UWI7
KEGG IDbmv:BMASAVP1_0735
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.20E-12, Aligned region: 19..154
Protein Sequence: 197 a.a.     [Download]
>gi|121597609|ref|YP_990340.1| lipoprotein [Burkholderia mallei SAVP1]
MRHKMGPFKSIAAALALGVLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQTCVYVVTAADW
LPTQGGDDSSCASRGQDSTVVADSRHVIAPNQLLQFSLNLPRSGELWLVADADYARRPANYGPLRVRVEG
RGLIHMAVWLDRDGIYNALLPGPVPVGGAIAPAAVRPDEPPPERKTKTTYGTRRSRQ
 
Nucleotide Sequence: 594 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c745438-744845 Burkholderia mallei SAVP1 chromosome II, complete sequence
GTGCGTCACAAGATGGGCCCCTTCAAATCGATCGCGGCGGCGCTCGCGCTCGGCGTGCTCGCCGGCTGCT
CGGCCTTCTCGTCGTCGAAGCCGGAAGAGCCGCGGCAGTTGCACGTGACGCTCGTCGGCGGCGCCCGGCT
GAACGTCGCGCCGACGGGCGAGCCGCGTCCGGTGCAGACGTGCGTGTATGTCGTGACCGCGGCCGACTGG
CTGCCGACGCAGGGCGGCGACGATTCGTCGTGCGCGTCGCGCGGGCAGGACAGCACGGTCGTCGCCGACT
CGCGGCACGTGATCGCGCCGAACCAGTTGCTGCAGTTCTCGCTGAACCTGCCGCGCTCGGGCGAGCTCTG
GCTCGTCGCCGACGCCGACTACGCGCGCCGGCCGGCGAACTACGGGCCGCTGCGCGTGCGCGTCGAGGGC
CGCGGCTTGATTCACATGGCTGTCTGGCTGGACCGCGACGGCATCTACAACGCGTTGTTGCCGGGGCCCG
TGCCCGTCGGCGGCGCGATCGCCCCGGCGGCGGTCCGCCCCGACGAGCCGCCGCCCGAGCGCAAGACGAA
AACCACCTATGGGACAAGGAGAAGCAGGCAATGA
 Primer design