SecReT6
Protein ID: 121597699
SecReT6 ID165
T6SS typei1
Gene symbolvirG
Locus tagBMASAVP1_0602
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]609249..609986 [-]
ProductDNA-binding response regulator
NoteVirG
UniProt IDA1UW57
KEGG IDbmv:BMASAVP1_0602
PDB IDNA
Domain hit(s) vs Pfam Response_reg [PF00072], Evalue: 1.50E-20, Aligned region: 10..117
Trans_reg_C [PF00486], Evalue: 9.70E-20, Aligned region: 161..235
Protein Sequence: 245 a.a.     [Download]
>gi|121597699|ref|YP_990210.1| DNA-binding response regulator [Burkholderia mallei SAVP1]
MTNVTRSPAVLVVEDDEPLRRVLCNYLSGHGMAVDGVGTAAAAAESVGRREYEMVLLDLGLPDGDGIDVL
LRWRETQRFPLICVTGRSEEADRIMGLEFGADDYVVKPYSLREVLARMRALWRRAEPSTTPVRRGRHPRA
YRFDGWTLNMNTRRLLTRDAQEIPLTVGEFNLLAFFLGSPSRVVTRAQLLECTRAFDDVFDRAVDVQIWR
LRKKIEKDPKHPELIRTERGVGYYFDAKEVETLWG
 
Nucleotide Sequence: 738 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c609986-609249 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGACGAATGTGACAAGATCGCCGGCGGTGCTCGTCGTCGAGGACGACGAACCGTTGCGGCGCGTGCTTT
GCAATTACCTGTCGGGCCACGGGATGGCCGTGGACGGCGTGGGAACGGCGGCAGCGGCCGCCGAATCGGT
CGGGCGGCGCGAATACGAGATGGTGCTGCTCGATCTCGGCCTGCCGGACGGCGACGGCATCGACGTGCTG
CTGCGCTGGCGCGAAACGCAGCGCTTTCCGCTCATCTGCGTGACGGGGCGCAGCGAAGAGGCCGATCGCA
TCATGGGCCTCGAATTCGGCGCGGACGATTACGTCGTGAAGCCGTACTCGCTGCGCGAGGTGCTCGCCCG
GATGCGCGCGCTGTGGCGGCGCGCCGAGCCGTCGACGACGCCCGTGCGGCGCGGCAGGCATCCGCGTGCG
TACCGCTTCGACGGATGGACGCTGAACATGAACACGCGCCGGCTGTTGACGCGCGATGCGCAGGAAATTC
CGCTGACGGTCGGCGAATTCAACCTGCTCGCGTTCTTTCTCGGCTCGCCGTCGCGCGTCGTCACGCGCGC
GCAGTTGCTCGAGTGCACGCGTGCGTTCGACGACGTGTTCGATCGCGCGGTCGACGTGCAGATCTGGCGG
CTGCGCAAGAAAATCGAGAAGGATCCGAAGCATCCCGAACTGATTCGAACCGAGCGGGGCGTCGGCTACT
ACTTCGACGCGAAAGAGGTGGAGACGCTATGGGGATGA
 Primer design