SecReT6
Protein ID: 121597741
SecReT6 ID166
T6SS typeN/A
Gene symbol-
Locus tagBMASAVP1_0747
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]760822..761349 [-]
Producthypothetical protein
NoteTssD
UniProt IDA1UWJ9
KEGG IDbmv:BMASAVP1_0747
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-31, Aligned region: 9..150
Protein Sequence: 175 a.a.     [Download]
>gi|121597741|ref|YP_990352.1| hypothetical protein BMASAVP1_0747 [Burkholderia mallei SAVP1]
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFEFRMVSNKASP
KLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPISQLGHASGEVDGVLPTDQIR
INFVQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
 
Nucleotide Sequence: 528 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c761349-760822 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGGCAAATGCTTTGGTTGATTACTTCTTGCAGATCGATGGCGTCGAGGGTGAGTCGACCGATCAGCAAT
ATCCCGGTCTGATCCAGATCCAGAGCTGGCAGTGGGCGGAAGAGAACTCGGGCCGCTGGGGCTTCGGCAG
CGGCGGCGGCGCGGGCAAGGTCGAGATGAAGGACTTCGAGTTCCGCATGGTGTCGAACAAGGCGTCGCCG
AAGCTGTTCCTGATGTGCGCGACGGGTGAGCACATCCAGAATGCGAAGCTGATCTGCCGCAAGTCGGGCA
AGGGCCAGCAGGAGTTCCTGACGATCTCGTTCGCGAGCGGCCTCGTGTCGTCGTTCCGCACGCTCGGCAA
CATGCCGATCTCGCAGCTCGGTCACGCGAGCGGCGAAGTCGACGGCGTGCTGCCGACGGATCAGATCCGC
ATCAACTTCGTCCAGATCGAGTTCGAGTACCGCGAGCAGCGCAACGACGGCACGATGGGCGCCGTGATCA
AGGCGGGCTACGACCTGAAGCAGAACGCGCCGATCTAA
 Primer design