SecReT6
Protein ID: 121597790
SecReT6 ID167
T6SS typei3
Gene symbol-
Locus tagBMASAVP1_0929
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]943704..944999 [+]
ProductSciS protein
NoteTssM
UniProt IDA1UX25
KEGG IDbmv:BMASAVP1_0929
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 2.60E-36, Aligned region: 24..52
DUF1215 [PF06744], Evalue: 2.60E-36, Aligned region: 133..257
Protein Sequence: 431 a.a.     [Download]
>gi|121597790|ref|YP_990528.1| SciS protein [Burkholderia mallei SAVP1]
MLRSFAAPDSPLERLARAAVHETTLAQPEASADRSFLQKASAQLSQQADKALGVRAQERVERELVDNRFA
GLREMVTGRADTQTDARPGAPAGKSGLDAVANLLNDYYTALTVSDDALANNSMPPANDTAAKLKMAAQTM
PAPFRSVLTGLAAQGSREVNRGIGQLLSRQLQATVSDVCRLAIEGNYPFAPDSKRDVGIEDFTRVFAQGG
VIDDFFAKTLAPFVDTSTRPWRYKTLPGATEPVEGPDLEPFQHAKAIREVFFGAPGQKQMAWKADIRIPE
LDPTITSLAIDVDGQTALYQHGPVAPFAVSWPGPRGGVHAEITASPRIRPDTSAVSTDGPWALLRLLQKG
RVSGTATPGRTRVTLDFDGRKAVLDLASTGSVANPLTSDVLKTFRCPGSMPMFSLADTGAPPGLPPGSPA
APTSRVARDGR
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|121596444|ref|NC_008784.1|:943704-944999 Burkholderia mallei SAVP1 chromosome II, complete sequence
GTGCTGCGCAGCTTCGCGGCGCCGGATTCGCCGCTCGAGCGGCTCGCGCGCGCGGCGGTTCACGAGACGA
CGCTCGCGCAGCCCGAAGCGAGCGCCGATCGCTCGTTCCTGCAAAAGGCGTCCGCCCAGTTGAGCCAGCA
GGCGGACAAGGCGCTCGGCGTGCGCGCGCAGGAGCGCGTCGAGCGCGAGCTCGTCGACAATCGCTTCGCG
GGCCTGCGCGAAATGGTGACGGGCCGCGCGGACACGCAAACGGACGCGCGCCCGGGCGCGCCGGCCGGCA
AGAGCGGGCTCGATGCGGTCGCGAACCTGCTGAACGACTACTACACGGCGCTGACCGTCTCGGACGACGC
GCTCGCGAACAACAGCATGCCGCCCGCGAACGATACCGCGGCGAAACTGAAGATGGCCGCGCAGACGATG
CCCGCGCCGTTTCGCTCGGTGCTGACCGGGCTCGCCGCGCAGGGCTCGCGCGAAGTGAACCGCGGCATCG
GCCAGTTGCTGTCGCGGCAGTTGCAGGCGACGGTAAGCGACGTTTGCCGCCTCGCGATCGAGGGCAACTA
TCCGTTCGCGCCCGACAGCAAGCGCGACGTCGGCATCGAGGACTTCACGCGCGTGTTCGCGCAAGGCGGC
GTGATCGACGACTTCTTCGCGAAGACGCTCGCGCCGTTCGTCGACACGTCGACGCGGCCTTGGCGCTACA
AGACGCTGCCCGGCGCGACCGAACCGGTGGAGGGCCCCGATCTCGAACCGTTTCAGCACGCGAAGGCGAT
TCGCGAAGTGTTTTTCGGCGCGCCCGGCCAGAAGCAGATGGCGTGGAAGGCCGACATCCGGATTCCCGAA
CTGGACCCGACGATCACGAGCCTCGCGATCGACGTCGACGGACAGACGGCGCTCTATCAGCACGGCCCCG
TCGCGCCGTTCGCGGTGAGCTGGCCGGGGCCGCGCGGCGGCGTGCACGCGGAGATCACCGCGAGCCCGCG
CATCCGGCCGGACACGTCGGCGGTGTCGACGGACGGCCCGTGGGCGCTGCTGCGCCTGCTTCAGAAGGGA
CGCGTGAGCGGCACGGCGACGCCCGGGCGCACGCGCGTCACGCTCGACTTCGACGGCCGCAAGGCGGTGC
TCGACCTCGCGAGCACGGGCAGCGTCGCGAATCCGTTGACGAGCGACGTGCTGAAGACGTTCCGGTGCCC
GGGCTCGATGCCGATGTTCAGTCTCGCGGACACCGGCGCGCCGCCGGGCTTGCCGCCCGGGAGCCCGGCG
GCGCCGACGTCGCGCGTCGCGCGCGACGGGCGGTGA
 Primer design