SecReT6
Protein ID: 121597840
SecReT6 ID165
T6SS typei1
Gene symbol-
Locus tagBMASAVP1_0601
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]607360..609252 [-]
Producthypothetical protein
NoteTssA
UniProt IDA1UW56
KEGG IDbmv:BMASAVP1_0601
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 67..126
ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 590..600
Protein Sequence: 630 a.a.     [Download]
>gi|121597840|ref|YP_990209.1| hypothetical protein BMASAVP1_0601 [Burkholderia mallei SAVP1]
MSERRPPGGAAARARMPIDVQALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDWRA
ATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQWL
VDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEVAD
EADVAEAAEAAEAADVADVADVADVADVADVADVADVAETAEADAHGSTGGPAAEIAIAAAEQALIDPAG
RAAPSAGTDTNANADAARQPARLDEAAGRDRALADALAQLHCVATAFAQADWADARGFRLRRVACWSSVC
ALPETDAENGRTRIAAPSASIVGAAKNIDEDGEPVAAVRFAEAHAQAFPLWLDLQRIAARALARAGGDGA
DARREVETAVRALLARLPGLDALTFADGTPFADDATRAWLGELGAPVVAADAVSPSSLPLSPRPSPPERS
SPMAGEPARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAIDRATSAEQRLRARVRLCELARDHW
PHEVPEAFARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDAARAMRLSM
 
Nucleotide Sequence: 1893 bp     [Download]
>gi|121596444|ref|NC_008784.1|:c609252-607360 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGAGCGAACGGCGCCCGCCCGGCGGCGCGGCGGCGCGCGCGCGCATGCCGATCGATGTCCAAGCGCTCG
CCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGCGAGGTT
CGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGGCGCGCG
GCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATCTGGCGG
GTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCTCGTCGA
ACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAATGGCTG
GTCGATCGCGTCGACGCCATGCACGATGCAGGAGCCGCGGCATGCGGCGGCGCGTGCTCGGCCGAACTGG
TCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGCGACGACGACGCGCCGAC
GATGCGCGCGGTGCATGCGTTCGCGGAGCGATTGCCTGTTGAGGTGGTTGAGGTGGTGGAAGTGGCTGAC
GAGGCTGATGTGGCTGAGGCGGCTGAGGCGGCTGAGGCGGCTGATGTGGCTGATGTGGCTGATGTGGCTG
ATGTGGCTGATGTGGCTGATGTGGCTGATGTGGCTGATGTGGCTGAGACGGCCGAGGCCGATGCGCACGG
CTCGACGGGAGGGCCGGCCGCGGAAATCGCGATTGCCGCCGCCGAACAGGCTTTGATTGATCCGGCCGGT
CGAGCCGCGCCGAGCGCCGGCACGGATACGAACGCGAACGCAGACGCCGCCAGGCAACCGGCGCGGCTCG
ACGAAGCGGCCGGCCGCGACCGCGCGCTCGCCGATGCGCTCGCGCAATTGCATTGCGTCGCGACGGCGTT
CGCGCAAGCGGACTGGGCCGACGCGCGCGGCTTCCGGCTGCGCCGCGTCGCGTGCTGGTCGAGCGTGTGT
GCGCTGCCGGAAACGGACGCGGAGAACGGAAGAACGCGGATCGCCGCGCCGAGCGCTTCGATCGTCGGCG
CGGCGAAGAACATCGACGAGGATGGCGAGCCCGTGGCGGCGGTGCGCTTCGCCGAAGCGCATGCGCAGGC
GTTCCCGCTCTGGCTGGATTTGCAGCGCATCGCCGCGCGCGCGCTCGCGCGCGCGGGAGGCGACGGCGCC
GATGCGCGGCGCGAAGTGGAGACGGCGGTTCGTGCACTGCTTGCGCGGCTGCCGGGCCTCGACGCGCTGA
CGTTCGCGGACGGCACGCCGTTCGCCGACGACGCGACGCGCGCATGGCTCGGCGAGCTTGGCGCGCCTGT
TGTGGCGGCGGATGCGGTGTCGCCGTCGTCTTTGCCGCTTTCGCCGCGACCTTCGCCGCCTGAGCGATCG
TCGCCGATGGCGGGCGAACCGGCGCGCGCGCCGGGCGATGCGTGCGGGGCGAGCGCCGACGATGCAGTGG
ACCGAGCGTGCGCGTTTGCCGCGAGCGGCCAGCTCGATCTCGCGCTCCACGCGATTCAGCATGCGATCGA
TCGTGCGACGAGCGCCGAACAGCGGTTGAGAGCGCGCGTGCGGTTGTGCGAGCTTGCGCGCGACCATTGG
CCGCATGAGGTTCCTGAGGCGTTCGCGCGCGGCGTGATCGAACCGATTCGGCGGCACGATTTGCTCGCAT
GGAATCCGGAGCTGGCGCTCGACGGCTTGTCGGCCGCCTATGCGCTGCTGATTCGGCGCGATCGCGAATC
GGCGCACGCGAGGACGGTGCTTGACGAGATCGCGAGCGTCGACGCGGCGCGGGCCATGCGTTTGTCGATG
TGA
 Primer design