SecReT6
Protein ID: 121598014
SecReT6 ID165
T6SS typei1
Gene symbol-
Locus tagBMASAVP1_0616
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]629144..629941 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA1UW71
KEGG IDbmv:BMASAVP1_0616
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-25, Aligned region: 46..208
Protein Sequence: 265 a.a.     [Download]
>gi|121598014|ref|YP_990224.1| hypothetical protein BMASAVP1_0616 [Burkholderia mallei SAVP1]
MNARHIAPPAATRARRPMQPGRPSWPSRTYRACAARTCAAVLVALAALAGCAARVTEEQARADVRWDYAP
DALRIDIDASARLNEYLNAPHTLLLAVFQSADAKAFRQLADDPDRLRMTLAAGGPAADFIQTTRYVVAPG
QHVALSIDRAQQARYVGIVAGYYDADGPRAARLFEVPLRIDKRGWFSSTYRAAPRTLELKLRLGAQSITD
AREAPLNLPPPGARAWTALDSGAKTLALPSADANDGGSGKRDKRGNAAARAPRKQ
 
Nucleotide Sequence: 798 bp     [Download]
>gi|121596444|ref|NC_008784.1|:629144-629941 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGAACGCACGACACATTGCCCCGCCGGCCGCGACGCGCGCGCGCCGGCCGATGCAGCCCGGCCGGCCGT
CATGGCCGTCGCGAACGTATCGCGCATGCGCGGCTCGCACATGCGCTGCCGTGCTCGTCGCGCTCGCCGC
CCTCGCCGGCTGTGCGGCCCGCGTCACCGAAGAGCAGGCGCGCGCCGACGTGCGATGGGACTACGCGCCC
GACGCGCTGCGCATCGATATCGACGCGTCGGCGCGGTTGAACGAATACCTGAACGCGCCGCACACGCTGT
TGCTCGCGGTGTTCCAGAGCGCGGACGCGAAGGCGTTCCGCCAGCTCGCCGACGATCCGGACCGGCTGCG
CATGACGCTCGCGGCGGGCGGCCCCGCCGCGGACTTCATTCAGACGACCCGCTACGTCGTCGCGCCCGGC
CAGCATGTCGCGCTGTCGATCGATCGCGCGCAGCAGGCGCGCTACGTCGGCATCGTCGCCGGCTACTACG
ACGCCGACGGCCCACGCGCGGCGCGCCTGTTCGAGGTGCCGCTGCGCATCGACAAGCGCGGCTGGTTCTC
CTCCACCTATCGCGCCGCGCCGCGAACGCTCGAGCTGAAGCTCAGGCTCGGCGCGCAGAGCATCACCGAC
GCGCGCGAAGCGCCGCTGAACCTGCCGCCGCCGGGCGCGCGCGCATGGACGGCGCTCGACAGCGGCGCGA
AGACCCTGGCGCTGCCGAGCGCCGACGCGAACGACGGCGGCAGCGGCAAGCGCGACAAACGCGGCAACGC
CGCCGCCCGTGCGCCGCGCAAGCAATGA
 Primer design