SecReT6
Protein ID: 121598024
SecReT6 ID165
T6SS typei1
Gene symbol-
Locus tagBMASAVP1_0607
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]614826..615287 [+]
Producthypothetical protein
NoteTssE
UniProt IDA1UW62
KEGG IDbmv:BMASAVP1_0607
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.10E-19, Aligned region: 39..130
Protein Sequence: 153 a.a.     [Download]
>gi|121598024|ref|YP_990215.1| hypothetical protein BMASAVP1_0607 [Burkholderia mallei SAVP1]
MADRESSRAGEPRTLERRLLERIANREAGGEHDRPPPADVLAHSIIDHLRRILNTRQGHVPIDPAFGVPD
FTNLAGGFAQGSAREIEAQIERVITCYEPRLKAPRVSLAERGPDAATLRFSLDARLVIDAHDVPARFLTT
VTGNGKIDIRTIS
 
Nucleotide Sequence: 462 bp     [Download]
>gi|121596444|ref|NC_008784.1|:614826-615287 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGGCTGATCGCGAATCGTCGCGGGCCGGCGAGCCGCGCACGCTCGAGCGCCGGCTGCTCGAGCGGATCG
CGAACCGGGAAGCGGGCGGCGAGCACGATCGCCCGCCGCCCGCCGACGTGCTCGCGCACTCGATCATCGA
CCACCTGCGCCGCATCCTGAACACGCGGCAGGGCCACGTGCCGATCGATCCCGCCTTCGGCGTGCCGGAT
TTCACGAATCTCGCGGGCGGCTTCGCGCAAGGCTCCGCCCGCGAAATCGAAGCGCAGATCGAGCGCGTGA
TCACTTGCTACGAGCCGCGGCTGAAAGCGCCGCGCGTCTCGCTCGCCGAGCGCGGGCCCGATGCGGCGAC
GCTGCGCTTCAGCCTCGATGCGCGGCTCGTGATCGACGCGCACGACGTGCCGGCGCGCTTTCTGACGACC
GTCACCGGCAACGGAAAGATCGATATCCGAACGATTTCCTGA
 Primer design