SecReT6
Protein ID: 121598086
SecReT6 ID165
T6SS typei1
Gene symbol-
Locus tagBMASAVP1_0619
StrainBurkholderia mallei SAVP1
Repliconchromosome II [GenBank: NC_008784] [Browse all T6SS(s) in this replicon]
Location [Strand]632045..636112 [+]
Producthypothetical protein
NoteTssM
UniProt IDA1UW74
KEGG IDbmv:BMASAVP1_0619
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.40E-48, Aligned region: 171..416
ImcF-related_N [PF14331], Evalue: 3.40E-48, Aligned region: 1114..1154
Collagen [PF01391], Evalue: 3.40E-05, Aligned region: 584..636
Collagen [PF01391], Evalue: 3.40E-05, Aligned region: 665..675
Protein Sequence: 1355 a.a.     [Download]
>gi|121598086|ref|YP_990227.1| hypothetical protein BMASAVP1_0619 [Burkholderia mallei SAVP1]
MMIARIAALLALAALSWASALYFDWPLWCAPAVFCAALAGWLLCRVARRALRAVRARAQLARLDASERLP
AADAPELRVAARWRTALAALGRAQPAPRLRGRPRDALPWYLVIGPEGAGKTTALARARLASPLRHARDDA
AIAPTEDCDWWCFDDAVVLDLAGRFAAPGATDDDRRAWHALLEQLGRARARRGVNGVVVAIDAPRLIEAS
RDALTIEGSAIRERLEQLIRLFDRRFPVYVLVTQCDRLYGFDEWAAQLAPEQRERAFGYLGDHDADAFVA
RALDSLDARLGALRVALAARGEPPSPRALMLPHELACLRPALEAFARAAFGPNVYQETPYLRGLLFASGR
QAGGAPSLTLPDWLDAAPARTPGDAGLFLHDVFARVLPGERDAWLPVERPSRSRLVLRRLALAAWLLASV
AAGLLMSASFVGDMRTVELVRRDYPAHPRFTGEFAHDTATLARIGRVIADVERRDERRLVRPLAGATPVG
RLEAELKRRYVAHYRRSIEPTADRLFFGKPDGASDMRAANDARLAARIRNLVRYVNLMQARRRGADRETL
AQMPAPAVARATDGGGARGVDSVGVSGVSGVSGVSGVSGVSGVSGVSGVSGVSGVSGVSGVSGVSGVSGV
SGGVGGVGGARAAEGAGRAVRASGGRRAGDARAARGMRGAAGNAGAGAEIAPAADGVRDRDEGFARVSAL
AVDLIAWSAPDDRALAARVAAAQAELERLAYRDPDGAWLLALPDASMPRDVTLADFWPAAEPRTLPDAQP
AALRDVRVPAALTAAHRPAIDAFLDEMAQAVANRPKFAFHRDAFDTWYRARRIDAWRDFVARFPQGEQGL
TTQAQWRAVIDRIADHRDPFAALLARVDREFESERDDTLPPWLRFVRTTSHMLAPAMLAPARLPAASGGL
GAALGSISRSGGRALREALGGAPEQGRLTLERDAALRDALVDYERRVAALAADALAGPGAAYRLAADFHG
FGVDPSVQASAMRAADSALRDVKRLAGDRDVGGDVVWSLVGGPLRALIAYVERQASCALQDDWERDVLWP
LRRAATRDDVEGLLYGPQGAIWAFVDGPAKPFVRVGAARASALDTLGYRLPFTDAFLPLIDDAAARRVAQ
ARRDAERRAQQQAALELDERIASLGKQIDALRAQTVRFGIVAQPTDVNPDAQAKPFETVLTLQCAPQART
LTNYNLRVSEQIDWQPDRCGDATLRISLGGVTLVRRYAGSLGVARFVQDFRYGVRRFTPRDFPDAKAQLQ
RLGVRHIDVRYDFSGHDALLAHVGRIDALERARRDDLARQRRAANRQDDDAGGATAIARAAASVANAPGA
ALPRRIGVCWGDPAHDRPDGDGAQP
 
Nucleotide Sequence: 4068 bp     [Download]
>gi|121596444|ref|NC_008784.1|:632045-636112 Burkholderia mallei SAVP1 chromosome II, complete sequence
ATGATGATCGCGCGGATCGCCGCGCTGCTCGCGCTCGCCGCGCTCAGTTGGGCGAGCGCGCTCTATTTCG
ACTGGCCGCTCTGGTGCGCGCCCGCCGTGTTCTGCGCGGCGCTCGCCGGATGGCTGCTGTGCCGCGTCGC
GCGCCGCGCGCTGCGCGCGGTTCGTGCGCGCGCGCAGCTCGCACGGCTCGACGCATCCGAGCGCCTGCCC
GCGGCCGACGCGCCGGAGCTGCGCGTCGCCGCGCGCTGGCGCACCGCGCTCGCCGCGCTCGGGCGCGCGC
AGCCCGCGCCGCGCCTGCGCGGCCGGCCGCGCGACGCGCTGCCGTGGTATCTCGTGATCGGCCCCGAGGG
CGCGGGCAAGACAACCGCGCTCGCGCGCGCGCGCCTCGCGTCGCCGCTGCGGCACGCGCGCGACGACGCG
GCCATCGCGCCGACCGAGGACTGCGACTGGTGGTGCTTCGACGACGCGGTCGTGCTCGATCTCGCGGGCC
GCTTCGCCGCGCCCGGCGCGACCGACGACGATCGCCGCGCATGGCACGCGCTCCTCGAGCAGCTCGGCCG
CGCGCGTGCGCGCCGGGGCGTGAACGGCGTCGTGGTCGCGATCGACGCGCCGCGCCTCATCGAAGCGAGC
CGCGATGCGCTGACGATCGAAGGCAGCGCCATTCGCGAACGGCTCGAGCAACTGATCCGCCTGTTCGACC
GGCGCTTTCCGGTGTACGTGCTCGTCACGCAATGCGACCGGCTCTACGGCTTCGACGAATGGGCCGCGCA
GCTCGCGCCGGAACAACGCGAGCGCGCGTTCGGCTATCTCGGCGATCACGACGCGGATGCGTTCGTCGCG
CGCGCGCTCGACAGCCTCGACGCACGGCTCGGCGCGCTGCGCGTCGCGCTGGCGGCGCGCGGCGAGCCGC
CGTCGCCGCGCGCGCTGATGCTGCCGCACGAACTCGCGTGCCTGCGGCCCGCGCTCGAGGCGTTCGCACG
CGCGGCGTTCGGCCCGAACGTCTATCAGGAAACACCGTATCTGCGCGGGCTGCTGTTCGCGAGCGGCCGG
CAGGCGGGCGGCGCGCCGTCGCTGACGCTGCCCGACTGGCTCGACGCCGCGCCGGCGCGCACGCCCGGCG
ATGCGGGCCTGTTCCTGCACGACGTGTTCGCGCGCGTGCTGCCGGGCGAGCGCGACGCGTGGCTGCCCGT
CGAGCGGCCGAGCCGCTCGCGGCTCGTGCTGCGGCGCCTCGCGCTCGCCGCGTGGCTCCTCGCGAGCGTC
GCGGCCGGGCTGCTGATGAGCGCATCGTTCGTCGGCGACATGCGAACCGTCGAGCTGGTCCGCCGCGACT
ATCCCGCGCATCCGCGCTTCACCGGCGAATTCGCGCACGACACGGCGACGCTCGCGCGGATCGGCCGCGT
GATCGCCGACGTCGAGCGGCGCGACGAGCGGCGGCTCGTGCGCCCGCTCGCCGGCGCGACGCCCGTCGGC
CGGCTCGAAGCGGAACTCAAGCGCCGCTACGTCGCACACTATCGGCGCTCGATCGAACCCACCGCCGATC
GGCTGTTCTTCGGCAAGCCGGACGGCGCGAGCGACATGCGCGCGGCCAACGATGCGCGGCTCGCCGCGCG
CATCCGCAATCTGGTCCGCTACGTGAACCTGATGCAGGCGCGCCGGCGCGGCGCGGATCGCGAGACGCTC
GCGCAAATGCCCGCACCGGCGGTCGCGCGCGCGACGGATGGCGGTGGCGCTCGCGGAGTGGACAGTGTGG
GTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTC
TGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTTTCTGGTGTT
TCTGGCGGTGTAGGCGGTGTAGGCGGTGCGCGCGCCGCGGAAGGTGCGGGTCGCGCCGTCCGCGCGAGCG
GCGGACGGCGCGCAGGCGACGCGCGCGCCGCGCGCGGCATGCGCGGCGCCGCCGGCAACGCCGGCGCCGG
CGCTGAAATCGCACCCGCCGCAGACGGCGTTCGCGATCGCGACGAAGGGTTTGCGCGCGTCAGCGCGCTC
GCCGTCGACCTGATCGCGTGGAGCGCGCCCGACGATCGCGCGCTCGCCGCGCGCGTCGCGGCCGCGCAGG
CAGAGCTCGAACGGCTCGCGTACCGCGATCCGGACGGCGCGTGGCTGCTCGCGCTACCGGATGCCTCGAT
GCCGCGCGACGTGACGCTCGCCGATTTCTGGCCCGCCGCCGAGCCGCGCACGCTGCCCGACGCACAGCCC
GCCGCGCTGCGCGACGTGCGCGTGCCCGCCGCGCTGACGGCCGCGCATCGCCCGGCCATCGATGCGTTCC
TCGACGAGATGGCGCAGGCGGTCGCGAACCGGCCGAAGTTCGCGTTCCATCGCGACGCGTTCGACACGTG
GTACCGCGCACGGCGCATCGACGCATGGCGCGACTTCGTCGCACGCTTCCCGCAGGGCGAGCAAGGGCTG
ACGACGCAAGCGCAATGGCGCGCGGTGATCGACCGGATCGCCGATCACCGCGATCCGTTCGCGGCATTGC
TCGCGCGCGTCGATCGCGAATTCGAATCCGAGCGCGACGACACGCTGCCGCCGTGGCTACGGTTCGTGCG
CACGACATCGCACATGCTCGCCCCCGCGATGCTCGCGCCCGCGCGCCTGCCCGCGGCGAGCGGCGGCCTG
GGCGCCGCGCTCGGCTCGATCTCGCGCAGCGGCGGACGCGCGCTGCGCGAAGCGCTCGGCGGCGCACCCG
AGCAAGGCAGGCTCACGCTCGAGCGCGACGCCGCGCTGCGCGACGCGCTTGTCGACTACGAGCGGCGCGT
CGCCGCGCTCGCCGCCGACGCGCTCGCGGGCCCCGGCGCCGCGTACCGGCTCGCGGCCGATTTCCACGGC
TTCGGCGTCGATCCGTCCGTCCAGGCTTCCGCGATGCGCGCGGCCGACAGCGCGCTGCGCGACGTCAAGC
GGCTCGCGGGCGATCGCGACGTCGGCGGCGACGTCGTCTGGAGCCTCGTCGGCGGCCCGCTGCGCGCGCT
GATCGCGTATGTCGAGCGGCAGGCGTCGTGCGCGCTGCAGGACGACTGGGAGCGCGACGTGCTGTGGCCG
CTCAGGCGCGCGGCGACGCGCGACGACGTGGAGGGTCTGCTGTACGGCCCGCAAGGCGCGATCTGGGCGT
TCGTCGACGGCCCGGCGAAGCCGTTCGTGCGTGTCGGCGCGGCGCGTGCGTCGGCGCTCGACACGCTCGG
CTACCGGCTGCCGTTCACCGACGCGTTCCTGCCGCTCATCGACGACGCGGCCGCCCGGCGCGTCGCGCAA
GCGCGGCGCGACGCCGAGCGGCGCGCGCAACAGCAGGCGGCGCTCGAGCTGGACGAGCGGATCGCATCGC
TCGGCAAGCAGATCGACGCGCTGCGCGCGCAAACGGTGCGCTTCGGGATCGTCGCGCAGCCGACCGACGT
GAACCCGGATGCGCAGGCCAAGCCGTTCGAAACCGTGCTGACGCTGCAATGCGCGCCGCAGGCGCGCACG
CTGACGAACTACAACCTGCGCGTGTCCGAGCAGATCGACTGGCAACCCGATCGATGCGGCGACGCGACGC
TGCGCATCTCGCTCGGCGGCGTCACGCTCGTGCGCCGTTACGCGGGATCGCTCGGCGTCGCGCGCTTCGT
CCAGGACTTCCGCTACGGCGTGCGCCGCTTCACGCCCCGCGATTTCCCGGACGCGAAAGCGCAGCTTCAA
CGTCTCGGCGTGCGCCACATCGACGTGCGTTACGACTTCTCCGGGCATGACGCGCTGCTCGCGCACGTCG
GTCGGATCGACGCGCTCGAACGCGCGCGCCGCGACGACCTCGCGCGGCAGCGGCGCGCCGCGAACCGGCA
GGACGACGACGCGGGCGGCGCGACGGCGATCGCGCGGGCGGCGGCGTCCGTCGCGAATGCGCCGGGCGCC
GCGCTGCCCCGCCGCATCGGCGTGTGTTGGGGGGACCCGGCGCACGACAGGCCCGATGGCGACGGCGCGC
AACCGTGA
 Primer design