SecReT6
Protein ID: 121996972
SecReT6 ID170
T6SS typei2
Gene symbol-
Locus tagHhal_0163
StrainHalorhodospira halophila SL1
Repliconchromosome [GenBank: NC_008789] [Browse all T6SS(s) in this replicon]
Location [Strand]189780..193223 [-]
Producthypothetical protein
NoteTssM
UniProt IDA1WTE5
KEGG IDhha:Hhal_0163
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-27, Aligned region: 189..360
DUF1215 [PF06744], Evalue: 8.70E-27, Aligned region: 880..998
IcmF-related [PF06761], Evalue: 2.80E-21, Aligned region: 478..770
Protein Sequence: 1147 a.a.     [Download]
>gi|121996972|ref|YP_001001759.1| hypothetical protein Hhal_0163 [Halorhodospira halophila SL1]
MRGQASISQGAVGWLRMPAFLRRPFVWLLVAVLLAAVAVWFGLPLFGVDPAGWRLAGVLTLFGVAGLAVG
AVALRRARRLDRQQISGDEAEALAAAMDRPLRRLDRPSGPTVPGTGGRYRVPWYLVIGPARSGKSRLIRC
SGLHFPDDDDEWLAARGDGGTRHCDWWLSDRAVFLDTAGRYTTDPPAETGWYQLLGLLRRVRRRRPVDGV
LVTIDAGELAELDASGLRRWARALRTRLAELETDLGVRPPVLLIVTGVDCLPGYEAFVAAAGGGSWCGPW
GAAVESAADPGLAAQRLQAQADEARLGLMAAWAGETDAVGPFAFAADLRSVTGPLAELLRLLLRHDPYRR
SPSLQAVYLTGHAPGRPSLTPGLFTQAVVPLARGLRLSARRLAVRRLARVALVAGLLGVAGVLGHGTAEQ
YQSRLAQATAVAEGAAAVAYAVGTEDPEVGAKLEAVERVQGLKDGLRQRSETGGMAAFALDPGGRRVGEL
YAQLRGLLIELAGQALLPDAGRAVQQRLEVFADEWPGLEPPERQARREAYREALGAWLRLTGEDVPVDDD
RVAVLLARLVAAEQGLGTPEAESPLVRGLSRALSDPQQRRSVGERLDGSPGRRLVERAREQLRTPARPEP
ILERLLAEAELDLAPLTLEAIAPGGASRIWSSQRPVSGAFRGAAWETRLRPALERTLEGLRHPDPVLGRS
RRDVLGDQRSSALAKDVEARYLRAFVDHWLDWLEGVRWQSVGGGREQAAQLEEAADAGALAALLEGVHAQ
LAAHAGDVPVAALGQQLGQDLGRYRHDPRGRELFALLGSGEEEGDAGPLPEVEAALSRVAEQIGQQASAA
DPGRKAMERVALALAGEGSGCSLRAYRTTVRQALGPTSSAVRSALEPVLLGGMDAAWARLRAEAAEELEG
RWQAEVVEPFRRYLAGRFPLDADGADAALGDFEAFFAPEYGVLWQFKTEQLSPFLSGSDGQGGERRWRGG
GVGITAEVVGALGVAARIRDGLFEDSGQLQLRYRVSPVASADWVDMRWESDGEALRYRNGPPVSASLRWP
QGSPEPGRIAAVSAHNGAMGRVEAEGPWALFRLLSRAEEREQVRSSAVRVRWSLHEAQEASHQPVEFLLR
TEQSTPLLQWGDLSRFRLPTRLTQEEA
 
Nucleotide Sequence: 3444 bp     [Download]
>ref|NC_008789.1|:c193223-189780 hypothetical protein Hhal_0163 [Halorhodospira halophila SL1]
ATGAGAGGGCAGGCGTCCATCAGTCAGGGGGCGGTCGGGTGGCTGCGGATGCCCGCCTTCCTGCGGCGAC
CGTTTGTGTGGCTGCTGGTGGCCGTCCTGCTCGCCGCAGTGGCTGTCTGGTTCGGCCTGCCGTTGTTTGG
CGTCGATCCGGCCGGGTGGCGTCTGGCAGGCGTCCTGACCCTGTTCGGGGTGGCTGGTCTGGCGGTCGGG
GCTGTTGCGCTGCGGCGCGCCCGACGGCTGGATCGGCAGCAAATATCTGGGGACGAGGCCGAGGCCCTGG
CCGCGGCCATGGATCGCCCCCTGCGTCGGCTGGACCGCCCCTCGGGGCCAACGGTGCCGGGGACTGGTGG
GCGATACCGTGTGCCTTGGTACTTGGTCATCGGGCCCGCCCGGTCGGGTAAGAGCCGCCTGATCCGCTGC
AGCGGTCTTCACTTCCCCGACGACGATGATGAGTGGCTGGCTGCACGCGGTGACGGCGGCACCCGCCATT
GCGACTGGTGGCTTTCCGATCGGGCCGTTTTCCTCGATACAGCTGGGCGCTACACCACCGATCCCCCCGC
GGAGACCGGCTGGTATCAACTCCTCGGTCTGCTCCGGCGTGTTCGCCGGCGTCGCCCCGTCGATGGGGTG
CTGGTCACCATCGACGCCGGCGAGCTGGCCGAACTGGATGCATCGGGACTGAGGCGATGGGCGCGGGCCC
TGCGGACGCGCCTCGCGGAGCTCGAGACCGATCTCGGGGTGCGGCCGCCGGTGCTCCTGATCGTGACTGG
AGTGGACTGTCTCCCCGGCTACGAGGCGTTCGTGGCGGCAGCCGGGGGCGGTTCGTGGTGCGGGCCCTGG
GGGGCAGCGGTGGAGTCGGCCGCTGACCCCGGCCTGGCGGCGCAGCGGCTGCAGGCGCAGGCCGATGAGG
CGCGCCTGGGCCTGATGGCGGCTTGGGCCGGGGAGACCGATGCGGTTGGTCCGTTCGCCTTTGCCGCCGA
TCTGCGTTCGGTGACCGGCCCTTTGGCGGAGCTGCTGCGCCTGCTGTTGCGCCATGACCCTTATCGGCGC
TCGCCGTCCCTGCAAGCGGTGTACCTGACTGGCCATGCACCCGGACGACCGAGCCTGACACCGGGGCTCT
TCACCCAGGCTGTCGTCCCGCTGGCACGGGGGCTGCGCCTCTCCGCCCGGCGGCTGGCGGTTCGGCGGCT
GGCCCGGGTCGCGCTGGTCGCCGGGCTCCTCGGTGTCGCTGGCGTGCTCGGGCACGGTACCGCCGAGCAG
TACCAGAGCCGTCTCGCCCAGGCCACGGCGGTGGCCGAGGGGGCCGCCGCCGTGGCCTATGCGGTGGGCA
CCGAGGATCCGGAGGTCGGCGCCAAGCTGGAAGCGGTCGAGCGGGTCCAGGGGCTGAAGGATGGGCTCCG
ACAGCGCTCTGAAACCGGCGGCATGGCGGCGTTCGCGCTGGACCCGGGCGGCCGGCGGGTCGGCGAGCTG
TACGCGCAGCTGCGGGGGCTTCTGATTGAACTCGCCGGCCAGGCCCTGTTGCCGGATGCGGGGCGGGCCG
TGCAGCAGCGGCTCGAGGTATTCGCCGACGAGTGGCCGGGACTCGAACCGCCGGAGCGCCAGGCCCGCCG
AGAGGCGTATCGGGAGGCCCTGGGGGCTTGGCTCCGGCTCACCGGTGAGGATGTGCCGGTCGACGATGAT
CGGGTGGCCGTCCTGCTGGCCCGGCTCGTCGCCGCTGAGCAGGGTCTGGGTACACCGGAGGCGGAGAGCC
CGTTGGTCCGCGGCCTGTCCCGCGCGCTGTCGGACCCGCAGCAACGGCGCTCCGTGGGGGAACGACTCGA
CGGGTCACCCGGGCGTCGTCTGGTTGAACGGGCCCGGGAGCAGCTGCGAACCCCCGCCCGGCCGGAGCCG
ATCCTGGAGCGGCTGCTCGCCGAGGCCGAGCTGGACTTGGCGCCGTTAACCCTCGAGGCGATCGCCCCGG
GCGGTGCCTCGCGCATCTGGTCGAGCCAGCGGCCGGTATCCGGGGCGTTCCGGGGTGCCGCCTGGGAGAC
CCGTCTCCGGCCGGCGCTGGAGCGAACCCTGGAGGGCCTGCGGCACCCGGATCCCGTCCTCGGCCGCAGC
CGGCGGGACGTGCTCGGGGACCAGCGGTCCTCGGCCTTGGCCAAGGACGTCGAGGCGCGTTACCTGCGCG
CCTTCGTGGACCACTGGCTGGATTGGTTGGAAGGGGTGCGCTGGCAATCGGTGGGCGGCGGGCGCGAACA
GGCCGCACAGCTGGAAGAGGCCGCGGATGCCGGTGCCCTGGCGGCGCTGCTCGAGGGGGTACACGCCCAA
CTGGCGGCACACGCCGGCGACGTTCCGGTGGCGGCCCTGGGGCAGCAGCTGGGCCAGGATCTCGGTCGGT
ACCGACACGATCCGAGGGGACGGGAGCTCTTCGCCCTGCTGGGGTCGGGAGAAGAAGAAGGCGACGCGGG
ACCGCTGCCCGAGGTCGAGGCGGCCCTCTCCCGGGTGGCGGAGCAGATCGGCCAGCAGGCGTCCGCCGCC
GACCCGGGGCGCAAGGCCATGGAGCGGGTCGCGCTCGCCCTGGCGGGCGAGGGGAGTGGCTGTTCGCTGC
GCGCGTACCGGACCACAGTCCGGCAAGCGTTGGGCCCGACCTCCAGCGCCGTACGCAGCGCGCTGGAACC
GGTGCTCCTCGGCGGTATGGATGCCGCCTGGGCGCGGTTGCGGGCCGAGGCCGCCGAGGAGCTCGAGGGG
CGCTGGCAGGCCGAGGTGGTGGAGCCGTTTCGTCGCTACCTGGCCGGGCGGTTTCCGCTGGATGCCGACG
GTGCGGACGCCGCCCTGGGGGACTTCGAGGCCTTCTTTGCACCCGAGTACGGGGTGTTGTGGCAATTCAA
GACCGAACAGCTTAGTCCGTTCCTGAGCGGCAGCGACGGCCAGGGCGGTGAGCGGCGCTGGCGGGGCGGT
GGGGTGGGCATCACCGCCGAGGTGGTGGGGGCCCTGGGCGTGGCGGCCCGAATTCGCGACGGGCTGTTCG
AGGACTCGGGGCAGCTGCAACTGCGCTATCGGGTGTCGCCGGTCGCCAGCGCCGACTGGGTCGACATGCG
CTGGGAGTCCGACGGCGAGGCGCTGCGCTACCGCAACGGCCCGCCGGTCTCTGCGAGCCTACGCTGGCCC
CAAGGGTCCCCCGAGCCCGGCCGAATCGCCGCTGTCTCTGCCCACAACGGCGCGATGGGGCGGGTCGAGG
CGGAGGGCCCCTGGGCGCTGTTCCGGCTGCTCAGCCGTGCCGAGGAGCGCGAACAGGTCCGTTCCAGTGC
GGTCCGCGTGCGCTGGTCGTTGCATGAAGCGCAGGAGGCGTCGCATCAGCCGGTGGAGTTCCTCCTGCGC
ACCGAACAGAGCACCCCACTGCTGCAGTGGGGGGATCTGTCCCGCTTCCGTCTGCCGACCCGTTTGACCC
AGGAGGAGGCGTGA
 Primer design