SecReT6
Protein ID: 123442897
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2681
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2908619..2909098 [-]
Producthypothetical protein
NoteTssE
UniProt IDA1JTL7
KEGG IDyen:YE2681
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-17, Aligned region: 35..138
Protein Sequence: 159 a.a.     [Download]
>gi|123442897|ref|YP_001006872.1| hypothetical protein YE2681 [Yersinia enterocolitica subsp. enterocolitica 8081]
MEKKRQFLPTLLERLLDDEPKKLLEPHDKFFYDSRTMRKLVQRNIAEILNNANIDDRLDEQRHKWVAKSV
LNYGISPLVGRHSTPHNWTTIERIIREAIIRFEPRIIAESLVVNQQHNARNGIIQFEIRGLIEWDPYPID
LCIGGAYDVETDQAELRAR
 
Nucleotide Sequence: 480 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2909098-2908619 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGGAAAAGAAGAGACAGTTTTTGCCTACTCTGCTTGAGCGTTTACTTGATGATGAGCCTAAAAAATTGT
TAGAGCCTCATGATAAGTTTTTTTATGACTCACGTACGATGCGAAAACTGGTGCAGCGGAATATCGCTGA
AATATTAAATAATGCCAATATTGACGACCGGCTTGATGAACAGCGCCATAAGTGGGTGGCGAAGTCGGTT
TTAAATTACGGTATTTCGCCACTGGTGGGGAGGCATTCAACTCCCCATAACTGGACGACTATCGAGCGAA
TTATCCGTGAAGCAATCATCCGTTTTGAACCCCGGATCATCGCAGAGTCTCTGGTCGTCAATCAGCAGCA
TAATGCCAGAAATGGCATTATTCAGTTTGAAATCAGAGGCCTGATTGAGTGGGATCCGTATCCTATTGAT
TTGTGTATCGGCGGGGCCTATGACGTTGAAACCGATCAGGCAGAACTCCGCGCGCGTTAG
 Primer design