SecReT6
Protein ID: 123442898
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2682
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2909098..2909925 [-]
Producthypothetical protein
NoteTagJ
UniProt IDA1JTL8
KEGG IDyen:YE2682
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.50E-45, Aligned region: 144..263
TPR_11 [PF13414], Evalue: 0.00092, Aligned region: 43..76
TPR_11 [PF13414], Evalue: 0.00092, Aligned region: 106..137
TPR_14 [PF13428], Evalue: 0.0045, Aligned region: 35..65
TPR_14 [PF13428], Evalue: 0.0045, Aligned region: 104..137
TPR_7 [PF13176], Evalue: 0.0093, Aligned region: 39..58
TPR_7 [PF13176], Evalue: 0.0093, Aligned region: 81..94
TPR_7 [PF13176], Evalue: 0.0093, Aligned region: 113..135
Protein Sequence: 275 a.a.     [Download]
>gi|123442898|ref|YP_001006873.1| hypothetical protein YE2682 [Yersinia enterocolitica subsp. enterocolitica 8081]
MNTTNLNELLKSSSLAEIQSDVIATLKAKPADTNARELLFKLYCLAGLWQKALLQLETLTKFAPDMTKQA
ELYKNLVLSETLREDVLAGKRDPGTLGNPLPEWAVLMQQANQHLHEGDYSQSEELREQALSQAPESAGEN
SSATPFSWIADSDSRIGPVCEFISAGGYRWVPFADVQLMTISKPKNITDLVWAPAQLTVNNKVWYGYIPA
RYPLSLDADNDTKLGLKTEWSQPADSLYIGSGRKMFITDQNEYALFDIEEFRFDVEKFGFDEQAN
 
Nucleotide Sequence: 828 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2909925-2909098 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGAATACGACCAACTTAAATGAATTATTGAAAAGCAGCTCATTGGCCGAAATACAATCGGATGTTATTG
CCACGTTGAAAGCCAAGCCAGCAGATACCAATGCACGCGAGCTATTATTTAAGCTCTATTGTTTGGCTGG
GTTATGGCAAAAAGCGTTATTGCAACTTGAAACTCTGACTAAATTTGCCCCAGATATGACCAAGCAGGCA
GAGCTGTATAAGAATCTGGTCTTGAGTGAGACGTTGCGTGAAGACGTGTTAGCAGGGAAACGCGATCCAG
GAACCTTAGGTAACCCCCTGCCTGAGTGGGCGGTATTGATGCAGCAAGCTAACCAACATTTGCATGAGGG
TGATTACTCACAAAGCGAAGAACTGCGCGAGCAAGCATTGTCACAAGCCCCCGAAAGTGCTGGGGAAAAT
AGCTCAGCGACGCCCTTTTCATGGATAGCGGATAGTGATAGCCGCATCGGGCCGGTTTGTGAGTTTATCA
GCGCCGGCGGTTATCGTTGGGTACCTTTCGCTGATGTTCAATTAATGACGATTTCTAAGCCTAAAAATAT
TACAGACTTGGTATGGGCGCCGGCACAATTGACGGTGAATAATAAAGTTTGGTACGGCTATATCCCGGCA
CGTTATCCGTTATCTCTCGATGCTGATAATGACACTAAACTTGGCCTTAAAACTGAATGGAGCCAACCGG
CAGACTCACTCTATATTGGTTCAGGGCGGAAAATGTTTATTACCGACCAAAATGAGTACGCATTATTCGA
TATTGAAGAGTTTAGATTTGATGTTGAAAAGTTTGGATTTGACGAACAGGCTAATTAA
 Primer design