SecReT6
Protein ID: 123442900
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2684
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2911171..2913885 [-]
Producthypothetical protein
NoteTssI
UniProt IDA1JTM0
KEGG IDyen:YE2684
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-76, Aligned region: 29..348
Phage_base_V [PF04717], Evalue: 1.20E-24, Aligned region: 386..479
Gp5_C [PF06715], Evalue: 0.00023, Aligned region: 530..552
Gp5_C [PF06715], Evalue: 0.00023, Aligned region: 537..559
Gp5_C [PF06715], Evalue: 0.00023, Aligned region: 598..605
Protein Sequence: 904 a.a.     [Download]
>gi|123442900|ref|YP_001006875.1| hypothetical protein YE2684 [Yersinia enterocolitica subsp. enterocolitica 8081]
MSRTIKLSSPAMPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPSIPWQTASNVDLKALIGKEMTI
EMELDGNGLDYVKGVGKGTREISGLVEKARFIGRDANQAMFEIVLRPWFYLTDLTSDFKIFQNKNVVDII
DEVLADYNFPFEKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHDDHKQKLILVDHVGAHKRY
FSEAYHTIEYLSDEPKAGEEYITQFQTQETLTTGRWVYNDYDFTKSRADILTMDSKPRKTSFSDLEIYQW
PGDYDQPDIGEHLARVRIEERGALGSRAVGCGEVRGIVCGANFELQGFPVDKANREYMVISSRLSVSEVA
QLSRGDEFHYETTFTVQPTTKIYRHPQLTPKPKTSGPQNAIVVGPPGEEVWTDEYGRVKVRFVWDRYGKN
AESDSCWLRVSQAWAGNSFGGIYIPRIGQEVLVDCINGDPDRPLVSGSLYNNVTRPPWDLPANATQSGMV
SRTIGGGLTNYNGVRFEDKPGLEQYWEQAERDMARLTKNDETQVIGANADLSVGANRSVLVGANSTSTVL
GASAQSVALASSIQVGLARSVVVGATHALNVALANATNVGGANLTNVGGYNALSVGGAHQVAAGGAATLV
AGGAVAIGAGGELVLSADTIKIVGKKKVIIQGGEIHLNSDDCCGGGGGGAGGGLAALSSLAGLKLLGGGI
GLPLPLPPLPIPPIIPPIPPIDPPEPTAETPEPTIDPPEPTTETPEPTVTPEPTVTPEPTVTPEPTVTPE
PTVTPEPTVTPEPTVTPEPTVTPEPTVTPEPTVTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDTPEPTDT
PEPTDTPEPTDTPEPTDTPEPTDTPEPTVTPEPTVTPEPTDTPEPTEPPETPEPTPTDEQTPPP
 
Nucleotide Sequence: 2715 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2913885-2911171 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGTCAAGGACAATAAAGTTGAGCAGCCCGGCCATGCCCTATTTATTGGGTGAGCCTGCGCTGGTACTGT
CGAAGTTAGAAGGAGAGGAAGCCTTTTCGACTTTGTATTCATATACCATCACGGCAAAAACGCCGGCTAA
CCCCTCCATTCCTTGGCAGACAGCCTCTAATGTCGATCTCAAAGCCTTAATTGGTAAAGAGATGACCATT
GAAATGGAACTGGATGGTAACGGTCTCGATTATGTAAAAGGTGTCGGTAAAGGCACGCGTGAAATTTCTG
GTTTGGTCGAAAAAGCCCGATTTATTGGCCGTGATGCCAATCAGGCAATGTTTGAAATTGTCCTTCGACC
TTGGTTCTACCTCACAGATTTAACCTCTGACTTTAAGATTTTTCAAAATAAAAATGTAGTAGATATTATT
GATGAAGTGCTTGCTGACTATAACTTTCCGTTTGAAAAACGGCTGGCGACGACTTATCCAATACTCGACT
TCCAGGTGCAATACGGTGAAACCGACTTTAATTTCCTCCAGCGTTTAATGGAGGAGTGGGGTATTTACTG
GTTCTTTGAACATGATGATCATAAACAAAAATTAATTCTGGTCGACCATGTCGGTGCTCACAAACGTTAT
TTCAGTGAAGCTTACCATACCATTGAATATCTCTCGGATGAGCCAAAGGCCGGGGAAGAATACATCACCC
AATTCCAGACTCAGGAAACGCTAACTACTGGGCGCTGGGTCTATAACGACTACGATTTCACCAAATCTCG
TGCTGACATTTTGACGATGGACAGCAAGCCACGCAAAACCAGTTTTAGCGATCTCGAAATTTATCAATGG
CCTGGGGATTATGATCAGCCGGATATCGGGGAGCATCTGGCGCGAGTGCGTATTGAGGAGCGCGGCGCGT
TGGGTTCGCGTGCCGTCGGTTGTGGCGAAGTTCGTGGCATCGTTTGCGGTGCTAACTTCGAACTGCAAGG
CTTCCCGGTTGATAAAGCTAACCGCGAATACATGGTTATCTCCAGCCGTTTGTCGGTTTCTGAAGTGGCA
CAGCTATCCCGTGGGGATGAGTTTCACTATGAAACTACGTTTACGGTTCAGCCAACCACCAAGATCTATC
GCCATCCACAACTTACACCAAAGCCAAAAACCAGCGGGCCACAGAATGCTATCGTTGTGGGCCCACCGGG
CGAAGAGGTATGGACTGATGAATATGGCCGGGTAAAAGTACGTTTTGTCTGGGACCGTTACGGCAAAAAC
GCAGAGTCGGACTCATGCTGGTTACGCGTGAGCCAGGCTTGGGCTGGGAACAGTTTTGGTGGCATTTACA
TTCCGCGTATTGGCCAGGAAGTGTTGGTGGACTGCATCAATGGCGACCCGGATCGCCCGTTGGTCAGTGG
TAGTCTCTACAATAACGTGACTCGCCCACCTTGGGATTTACCTGCGAATGCCACACAAAGTGGCATGGTC
AGCCGTACTATTGGCGGAGGGCTAACCAACTATAACGGCGTGCGTTTTGAGGATAAACCGGGCCTGGAGC
AATACTGGGAGCAGGCCGAGCGCGATATGGCGCGTCTGACGAAAAATGATGAAACACAAGTCATTGGCGC
TAATGCTGATCTGAGTGTGGGGGCCAACCGCAGCGTGCTTGTAGGGGCTAATTCGACATCAACTGTTCTT
GGTGCTTCCGCGCAATCCGTCGCTTTAGCGTCTTCAATACAAGTTGGATTGGCACGGAGTGTGGTCGTGG
GAGCCACTCATGCTCTGAATGTCGCTTTAGCCAATGCCACCAACGTGGGTGGTGCCAACCTGACCAACGT
CGGTGGTTACAACGCACTTTCTGTCGGTGGTGCTCATCAGGTAGCCGCTGGCGGTGCTGCGACACTGGTT
GCTGGTGGTGCTGTGGCGATCGGTGCGGGTGGTGAGCTGGTGCTCAGTGCCGATACCATCAAGATTGTCG
GCAAAAAGAAAGTCATTATTCAAGGGGGAGAGATCCACCTTAACTCTGATGATTGTTGTGGCGGAGGCGG
CGGCGGTGCAGGGGGGGGCTTAGCCGCGCTTTCAAGCTTGGCGGGACTGAAGCTACTGGGGGGAGGTATC
GGGCTGCCATTGCCATTACCACCATTGCCAATACCACCGATCATTCCACCGATACCGCCAATTGATCCGC
CGGAACCAACGGCTGAAACGCCGGAGCCAACAATTGACCCGCCGGAACCAACGACTGAGACACCAGAGCC
GACGGTAACGCCAGAGCCGACGGTAACGCCAGAGCCGACGGTAACGCCAGAGCCGACGGTAACGCCAGAG
CCGACGGTAACGCCAGAGCCGACGGTAACGCCAGAGCCGACGGTAACGCCAGAGCCGACGGTAACGCCAG
AGCCGACGGTAACGCCAGAGCCGACGGTAACGCCGGAGCCGACCGATACGCCAGAGCCGACCGATACGCC
GGAGCCGACTGATACGCCAGAGCCGACTGATACGCCGGAGCCGACCGATACGCCAGAGCCGACTGATACG
CCAGAGCCGACCGATACGCCAGAGCCGACCGATACGCCGGAACCGACCGATACGCCAGAGCCGACCGATA
CGCCAGAGCCGACGGTAACGCCAGAGCCGACCGTAACGCCGGAGCCGACCGATACGCCAGAGCCGACTGA
ACCACCAGAGACACCAGAACCAACGCCAACGGATGAACAGACGCCTCCGCCTTGA
 Primer design