SecReT6
Protein ID: 123442901
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2685
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2914034..2917867 [-]
Producthypothetical protein
NoteTssM
UniProt IDA1JTM1
KEGG IDyen:YE2685
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.30E-85, Aligned region: 583..898
ImcF-related_N [PF14331], Evalue: 2.30E-70, Aligned region: 251..535
DUF1215 [PF06744], Evalue: 3.60E-29, Aligned region: 627..642
DUF1215 [PF06744], Evalue: 3.60E-29, Aligned region: 710..732
DUF1215 [PF06744], Evalue: 3.60E-29, Aligned region: 1014..1127
Protein Sequence: 1277 a.a.     [Download]
>gi|123442901|ref|YP_001006876.1| hypothetical protein YE2685 [Yersinia enterocolitica subsp. enterocolitica 8081]
MSYLNRLFSGWAMKRILLVGCFLLLAAAIWFLGPFLGFGEARPLEGYEPRIIFLLLALALLLGFWFNVPR
FVMLAVVACAAVWVIAPFILVGDSHPLEDPLRRGAIIAFIAFITILYGVWRFMRALALNPALLDNFINPK
KGQSELEPDFSEINAVIRNGINYVRRIHSGIPTWKRFFVSSRWRSELPWFMVLGTKSAGKTSLILSSGQD
FPLPEQLDRIGKENVPTQHCECLFSNDALFLDTAGKYIDDGKEHQIEWDGILKALKKYRPVKAVNGVIVA
ISVTDILGKSKAELLTLSATLRARLDDVRGVLGVRFPVYVTITKLDQLSGFDEYFRNLTAEDREQIWGVT
FPYNEEKGRADMELEQRISTELALLENRISNNMHVRQQEEYSVTDRKGMYALPQDFRLLSQRVTEVLQNV
FFASRFDETKFHTTLRGIYFVSSCQPANIGLLNNSTLVQKWRNVISHMKPASPASLSQRSDDEGQLISET
AYGKQYFLKQLFRDVITQDGDLVSYNLKVQSKYRFQNLLGHVACIGLAVWLVWAFLISFQHNDGYLQAVG
TKLQHLESSVSRYVKTTNEQMLPTLLNATQQLPEYGTLDVENPSLDWRYGLYTGGAVSRGANNLYQFFLQ
KYLFPMVEREAEVSLKNAINSGDSEAVYVALKLYLMLTDEEHFDQNYVVDKVTQAWQKSGKIEPYEEKGI
FASHLNTLFTQKAWRQYGQAADSELIKQARAMLAEKTETARLWGRVQSHLQAQAPANLTLRKMVGENATQ
VFTLSDDELLHEGVPGLYTHAGYHQVVKKKLTPLLMQLQQEDRWVMAQPLTSSFDPLALQQDVLTLYLKE
YTDYWKRFLSSVRLISVDADSGEYAEGLSLDIALLRTLVSENSPLLNLAKQSVKETTLIETVKEKTLLDD
ITIRNQGNLVNQAKKVQEKIAFRENKLVQEFVDSQFDGLRAFVKGEPSDGENNSNLSVIQGTQMSRVIGA
LNDQYTRLVVFNSAFEYGDIPPISHGGERIAIESQTWPDPFSNIIAPLLTSSSQKFENKVITHTSKAIDM
GVGEICRNTLQGRYPFADSEKVVSLSDFERFFGAGGTVDSYFKKNLESKVDTTTTPWRYKGSASRDGLEF
FEQAAVIRNALFNASEGRKVALDFSVSVRYLAPSITQLIMNFDGNIVRYSHGPVTPSFFKWPGVRQGTMV
SLTAQRQQASAMPDILLRGPWALLKWADKADEVAQDASGMQLLTYVMGKDRVELEVSGLTYGNESISELL
RGFQCPSVLNDDMHGIW
 
Nucleotide Sequence: 3834 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2917867-2914034 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGTCTTATTTGAATCGATTGTTTTCTGGCTGGGCCATGAAACGAATATTGCTGGTGGGCTGCTTTCTAT
TACTGGCTGCCGCAATATGGTTTTTGGGGCCTTTCCTCGGATTTGGCGAGGCGCGACCGCTTGAAGGTTA
TGAACCCAGAATTATTTTCTTACTGCTGGCTCTGGCTCTGTTATTGGGTTTTTGGTTTAACGTGCCGCGC
TTTGTTATGTTGGCGGTGGTCGCCTGCGCTGCGGTATGGGTTATCGCGCCCTTTATATTAGTAGGGGATA
GCCATCCGCTGGAAGATCCACTGCGTCGTGGCGCAATTATCGCTTTTATTGCCTTTATCACCATTCTTTA
TGGTGTGTGGCGTTTTATGCGGGCTTTAGCGCTCAACCCTGCGCTATTGGATAATTTTATCAACCCGAAG
AAAGGTCAATCTGAACTTGAACCTGACTTTTCTGAAATCAATGCGGTGATTCGCAATGGCATAAATTATG
TCCGTCGTATTCACAGTGGCATTCCAACCTGGAAGCGTTTTTTTGTTTCCAGCCGCTGGCGTAGCGAACT
GCCTTGGTTCATGGTGCTGGGCACCAAGAGTGCTGGTAAAACCTCACTGATCCTCTCATCAGGACAAGAT
TTCCCTCTGCCTGAGCAGTTGGATCGCATCGGTAAAGAAAATGTACCGACTCAGCATTGCGAATGTCTGT
TCTCTAATGATGCCCTATTTTTAGATACCGCCGGTAAGTACATTGATGACGGCAAAGAGCATCAAATTGA
ATGGGATGGCATCTTAAAGGCGCTGAAAAAGTATCGTCCGGTCAAGGCGGTTAACGGCGTTATTGTGGCT
ATTTCAGTCACCGACATTTTGGGTAAAAGTAAAGCCGAGTTATTGACGCTATCGGCCACGCTGCGCGCGC
GTTTAGATGATGTTCGTGGTGTGCTCGGTGTTCGTTTCCCGGTATATGTGACTATCACCAAACTGGATCA
ACTGTCTGGTTTTGATGAGTATTTCCGCAATTTGACCGCCGAAGACCGCGAACAAATCTGGGGGGTGACT
TTCCCTTATAACGAGGAGAAAGGGCGCGCGGATATGGAGCTTGAGCAACGTATCAGCACTGAGTTGGCAC
TGCTTGAAAACCGCATCAGCAACAACATGCATGTGCGTCAGCAAGAAGAGTATTCCGTCACTGATCGTAA
AGGCATGTATGCATTACCGCAGGATTTCAGATTGTTGTCCCAACGGGTGACTGAAGTCTTGCAGAATGTG
TTTTTTGCCTCGCGTTTTGATGAGACAAAGTTCCATACCACGTTGCGTGGGATCTATTTTGTCAGCAGTT
GCCAGCCTGCGAATATTGGGCTGTTAAATAACAGCACCCTGGTCCAGAAATGGCGCAATGTTATTAGTCA
TATGAAGCCTGCATCCCCGGCCTCGCTTTCGCAAAGAAGTGATGATGAAGGTCAATTGATCAGCGAAACG
GCTTATGGAAAACAATATTTCCTCAAGCAGCTATTCCGCGACGTCATCACCCAAGATGGGGATTTGGTGA
GTTATAACCTCAAAGTGCAATCCAAATACCGTTTCCAGAATTTATTGGGACACGTGGCTTGTATCGGGCT
GGCGGTGTGGCTGGTATGGGCATTCCTTATCAGTTTCCAGCACAACGATGGCTATTTACAGGCGGTTGGT
ACCAAGCTCCAGCACTTAGAGAGCAGCGTTAGCCGTTATGTTAAAACCACCAATGAGCAGATGTTACCCA
CGCTGTTGAATGCCACTCAGCAGTTACCTGAGTACGGCACGCTGGATGTGGAAAACCCGAGTCTTGATTG
GCGCTATGGTTTATACACTGGCGGGGCGGTGTCTCGGGGCGCGAACAATTTGTATCAGTTTTTCCTGCAA
AAATACCTCTTCCCGATGGTTGAACGTGAGGCCGAAGTCTCATTAAAAAATGCGATCAATAGTGGCGATT
CTGAAGCGGTCTATGTTGCGTTAAAACTCTATCTCATGCTGACTGATGAAGAGCATTTCGATCAGAATTA
TGTGGTCGATAAAGTCACTCAAGCTTGGCAGAAGAGCGGGAAAATCGAGCCTTATGAGGAGAAAGGTATT
TTCGCCTCCCATTTGAATACGCTTTTCACCCAAAAAGCGTGGCGACAATATGGACAAGCGGCAGATAGCG
AGCTGATCAAACAGGCCAGGGCCATGCTGGCAGAGAAAACTGAGACTGCCAGACTGTGGGGGCGCGTTCA
ATCACATTTACAGGCACAAGCGCCCGCCAATCTGACATTACGTAAAATGGTGGGTGAGAATGCGACACAG
GTTTTTACCCTATCGGATGACGAATTACTGCATGAAGGGGTTCCGGGGCTATATACCCACGCCGGGTATC
ATCAGGTGGTTAAAAAAAAGCTTACGCCATTGCTGATGCAACTTCAGCAAGAGGATCGTTGGGTGATGGC
TCAGCCATTGACTTCTTCATTTGATCCTCTGGCGCTACAGCAAGATGTGCTAACCCTGTACTTGAAAGAA
TACACCGATTACTGGAAACGCTTCCTCTCCAGTGTGCGCCTGATTTCTGTTGATGCTGACAGTGGAGAGT
ATGCAGAAGGGTTATCTCTGGATATTGCGCTGTTGAGAACGCTGGTGTCAGAGAACTCACCTTTGCTCAA
TTTGGCAAAGCAGTCAGTGAAAGAAACGACGTTAATTGAAACCGTAAAAGAGAAAACACTACTCGACGAT
ATAACAATAAGAAATCAGGGAAATTTAGTTAACCAGGCTAAAAAAGTGCAGGAAAAGATCGCTTTTCGTG
AGAATAAGCTGGTTCAGGAATTTGTTGATAGTCAATTTGACGGACTGCGCGCTTTTGTTAAGGGCGAACC
GAGCGATGGGGAGAATAACAGTAACCTTTCTGTGATTCAGGGCACCCAGATGAGCCGGGTTATTGGTGCG
TTGAATGATCAATATACCCGTCTGGTGGTGTTTAACAGCGCGTTTGAATATGGCGATATCCCTCCGATCT
CTCATGGAGGGGAGCGTATCGCGATTGAGTCACAAACCTGGCCGGATCCGTTTAGCAATATCATTGCGCC
ACTTTTAACCAGTTCATCGCAGAAGTTTGAAAATAAAGTGATTACCCACACGTCGAAGGCTATCGATATG
GGGGTCGGTGAGATATGCCGCAATACCTTACAGGGGCGTTATCCCTTTGCTGATAGTGAGAAAGTCGTCA
GTTTGAGTGATTTTGAGCGCTTCTTCGGCGCGGGTGGCACGGTGGACAGTTACTTTAAGAAGAACCTGGA
AAGCAAAGTCGACACTACCACCACGCCTTGGCGTTATAAAGGCAGCGCAAGCCGTGATGGTCTGGAATTT
TTTGAACAGGCGGCGGTGATTCGCAATGCATTATTTAATGCCAGTGAAGGCCGCAAAGTGGCTTTAGACT
TCTCGGTATCCGTGCGTTATTTAGCCCCCTCAATTACGCAATTAATCATGAATTTTGACGGGAATATTGT
GCGCTATTCCCACGGCCCGGTGACGCCATCATTCTTCAAATGGCCGGGAGTTCGTCAAGGAACAATGGTG
AGTTTAACTGCTCAGCGCCAACAAGCTTCCGCGATGCCAGACATCCTGTTGCGTGGCCCTTGGGCATTGC
TGAAATGGGCTGATAAGGCTGATGAAGTGGCCCAAGACGCCAGTGGCATGCAACTTCTGACCTATGTCAT
GGGCAAAGATCGCGTCGAGCTGGAAGTGTCCGGTTTGACTTACGGTAATGAGAGTATCAGTGAACTGCTT
AGAGGCTTCCAATGCCCAAGTGTGCTCAATGATGATATGCATGGAATTTGGTGA
 Primer design