SecReT6
Protein ID: 123442902
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2686
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2917876..2919252 [-]
Productputative OmpA family protein
NoteTssL
UniProt IDA1JTM2
KEGG IDyen:YE2686
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.50E-55, Aligned region: 86..291
OmpA [PF00691], Evalue: 1.30E-16, Aligned region: 352..450
Protein Sequence: 458 a.a.     [Download]
>gi|123442902|ref|YP_001006877.1| putative OmpA family protein [Yersinia enterocolitica subsp. enterocolitica 8081]
MSDSSELNPGIPMPSFDQSRDADTNPQALGHFLLDEPGVYTESTQSGAAFSHEATRSPGFQPYDTAQLRG
ESVQQRVAKAVASPTPLLEAAQPLLRALSEMPQEIADASQVHILKESLKNEITLFSVVCDEADISWKKMA
IVRYCLCTALDEAAHTMSWGVMSGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYADCLEVLLRILG
LGFEGRYSIIEEGDRQLTKIRQGLLTLLQSTRDTVPTALSPHGLIAHQFRKKRGIFVPVRVSMLLCGFLI
AATFIGSKYFLSVPESDLLKRMAALQRPVIVPTVAVQKLRLAILLKDEIAKQLVSVDETSSRSKVIFKGD
TMFQVGSDKVRSEIMSVIERVAQEVHRVQGAVLIIGHTDSMPINKPGFPNNQVLSEKRAANVARFMEKAG
IPTDKIQFEGKGDTQPVSSNDDAAGRSQNRRVEIFVNY
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2919252-2917876 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGAGTGATAGCAGTGAATTGAACCCAGGGATACCGATGCCCTCCTTTGATCAAAGCAGAGATGCGGATA
CCAATCCGCAGGCGTTAGGCCATTTCTTGCTTGATGAGCCGGGTGTTTACACCGAGAGCACACAATCTGG
TGCGGCGTTCAGCCATGAGGCTACGCGCTCACCGGGTTTTCAGCCCTATGATACCGCCCAGCTTCGAGGC
GAAAGTGTCCAGCAGCGCGTGGCTAAAGCGGTCGCGTCTCCAACGCCATTATTGGAGGCGGCACAGCCAT
TGTTACGTGCCTTAAGCGAGATGCCACAAGAGATAGCGGATGCTTCGCAGGTTCATATATTAAAAGAGAG
CCTGAAGAATGAGATAACCCTGTTTAGTGTGGTATGTGATGAAGCGGATATCTCGTGGAAGAAAATGGCC
ATCGTCCGCTATTGCTTGTGTACCGCGCTAGATGAAGCGGCTCACACCATGTCGTGGGGCGTCATGTCGG
GTTGGTCGCAAAGCAACCTGCTAAACCATTTTGAAGGTGATAACGACGGCGGGAATAAATTTTTCCTGTT
AGTGGGCCGTCTGTCAATGAGCCCACATGAATATGCGGATTGCTTAGAGGTATTGCTGAGGATTTTAGGG
CTGGGTTTTGAAGGCCGTTACAGCATTATCGAAGAGGGTGACCGGCAATTAACCAAAATCCGTCAGGGAT
TGTTGACGTTACTGCAAAGTACCCGCGATACCGTTCCTACCGCGCTTTCTCCGCATGGATTAATCGCGCA
TCAGTTCCGCAAAAAGCGAGGGATCTTTGTTCCGGTTCGTGTGTCGATGCTGCTGTGTGGTTTCTTGATT
GCGGCCACCTTTATTGGCAGTAAATATTTTCTCTCCGTACCCGAAAGCGACCTGCTGAAGAGAATGGCAG
CCTTGCAACGTCCGGTTATCGTGCCAACCGTTGCGGTACAAAAACTACGTCTGGCTATTTTGTTAAAAGA
CGAGATAGCGAAGCAGCTAGTGAGTGTTGATGAAACAAGCAGTCGCAGCAAAGTCATCTTCAAAGGCGAC
ACCATGTTCCAGGTGGGTTCGGATAAAGTCCGGTCCGAAATCATGAGTGTCATCGAGCGTGTTGCGCAGG
AAGTTCATCGCGTACAGGGGGCGGTGCTGATTATTGGGCATACCGACTCTATGCCGATCAACAAACCAGG
TTTCCCTAATAACCAGGTGCTTTCTGAGAAACGTGCTGCCAACGTTGCACGCTTTATGGAGAAAGCGGGT
ATCCCGACTGACAAAATTCAGTTTGAAGGGAAAGGGGATACGCAGCCAGTCAGTAGTAATGACGATGCAG
CCGGGCGTTCACAAAACCGCCGTGTAGAAATCTTTGTTAATTATTGA
 Primer design