SecReT6
Protein ID: 123442903
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2687
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2919249..2920598 [-]
Producthypothetical protein
NoteTssK
UniProt IDA1JTM3
KEGG IDyen:YE2687
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-143, Aligned region: 19..447
Protein Sequence: 449 a.a.     [Download]
>gi|123442903|ref|YP_001006878.1| hypothetical protein YE2687 [Yersinia enterocolitica subsp. enterocolitica 8081]
MRTNKVVWSEGLFLRPQLFQQQERYLEYYAHKRAATITPFFWGFAQYEIDREALSYGKLVLRSGKGVLPD
GTPFDIPGHAELPEPLTITPDHLGKLIYLAVPLRLDNSDETIFDEYDMSSLARFYAYEADLSDTNAIRQG
PKPVQLSRLRLKLVSESEMTESWIGLPLAKVRAIQPDGSVLLHLEDYIPPVTGYAASSLLSEWLTHLNGL
VKMRADMLAKRLSNSDGKASASAEIVDYLLLQIFNKYEPSLDHLRNIPELPPIVLYQELAKFAGELSTFI
RTKTRRPRPAPGYDHGKLYPSIRPLVDDVHELLNQILVRAGQMIPLEPKGNGVWSASVLPNELRSFSNLV
LAVHAQLPMDVLQHQFSVQTKISAPQQLHELVRSHLPGLELQRLPVPPRQIPYSAGYVYFELMKSGPFWD
KVSNAGAIALHVAGDFPALKMELWGIRDS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2920598-2919249 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
GTGAGAACTAACAAAGTCGTTTGGAGTGAGGGTCTTTTTCTTCGCCCGCAACTTTTTCAACAGCAAGAGC
GGTATCTTGAATATTACGCTCATAAACGAGCCGCCACGATTACCCCATTCTTTTGGGGATTCGCGCAATA
TGAAATTGATCGCGAAGCGCTCTCCTATGGCAAGTTGGTACTGCGATCTGGCAAAGGGGTATTACCGGAC
GGTACGCCTTTTGATATTCCCGGTCATGCGGAACTGCCTGAGCCACTTACTATCACCCCAGATCATTTGG
GCAAACTAATCTATCTGGCGGTTCCGTTGCGGCTGGATAACAGTGATGAAACTATTTTTGACGAATATGA
CATGAGCTCATTGGCGCGTTTTTATGCCTATGAAGCAGACCTCAGTGACACTAATGCTATTCGCCAGGGG
CCGAAGCCGGTGCAGTTGTCGCGGCTGCGGCTTAAATTGGTTTCTGAAAGCGAAATGACCGAATCATGGA
TTGGGTTGCCACTGGCCAAAGTCAGGGCGATTCAGCCTGATGGTAGCGTACTGCTGCATCTGGAAGACTA
CATTCCTCCGGTGACGGGATACGCGGCGAGTTCACTGCTGTCAGAGTGGCTGACTCATCTTAATGGCTTG
GTCAAAATGCGTGCCGATATGCTGGCTAAACGTCTGTCAAACAGTGATGGCAAAGCCAGCGCCAGTGCTG
AAATTGTCGACTACTTGCTGCTGCAAATTTTTAATAAATACGAGCCAAGTCTGGATCATCTGCGCAATAT
TCCAGAATTACCGCCAATCGTGCTTTATCAAGAACTTGCCAAGTTTGCCGGTGAATTATCCACCTTTATT
CGGACCAAAACGCGTCGGCCGCGCCCGGCTCCGGGATATGACCACGGGAAACTCTACCCGTCGATTCGCC
CATTGGTGGACGATGTGCATGAATTGCTCAATCAGATTCTGGTGCGTGCAGGGCAGATGATCCCGCTGGA
GCCAAAAGGGAATGGCGTATGGTCTGCCTCTGTGCTGCCTAATGAATTACGTTCATTTTCCAATTTGGTA
TTGGCTGTTCATGCACAATTACCAATGGACGTATTGCAGCATCAATTCTCAGTACAGACCAAAATCAGTG
CGCCACAACAGTTGCATGAACTGGTGCGCTCACATTTACCGGGTCTCGAATTACAGCGGTTGCCGGTTCC
ACCGCGGCAAATTCCGTACAGTGCGGGATACGTTTATTTCGAATTGATGAAAAGCGGGCCGTTTTGGGAC
AAAGTTTCCAATGCAGGGGCCATTGCACTACACGTGGCTGGCGATTTCCCTGCATTGAAAATGGAGCTCT
GGGGGATTAGAGATTCATGA
 Primer design