SecReT6
Protein ID: 123442904
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2688
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2920602..2921153 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA1JTM4
KEGG IDyen:YE2688
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.00E-34, Aligned region: 27..176
Protein Sequence: 183 a.a.     [Download]
>gi|123442904|ref|YP_001006879.1| hypothetical protein YE2688 [Yersinia enterocolitica subsp. enterocolitica 8081]
MIRLSMKKNIRWFNRITQYFFVALVTLLVMACSSKPQPEPVDKLSVELITAKNINPNDKGVANPLRITVY
TLKNTDEFKSSDFFTITEEGTPSLKEQMEKVFDGIMLPNETKTIELTLNSGVTAIGVVAAYREIEQAEWN
AVFSPLPKKRVQPWYKKWWSGKQNDPVVKVRVERLSISIKEMD
 
Nucleotide Sequence: 552 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2921153-2920602 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
TTGATTAGGTTGAGTATGAAAAAAAATATCCGTTGGTTTAATCGGATTACACAATACTTTTTCGTGGCAT
TGGTCACGCTATTGGTCATGGCATGTAGCTCGAAGCCTCAACCCGAACCGGTTGATAAATTGAGCGTCGA
GCTGATTACGGCAAAAAATATCAATCCAAATGACAAAGGTGTCGCTAATCCGTTAAGGATCACAGTTTAT
ACCCTGAAGAATACGGATGAATTTAAGTCGAGTGATTTCTTCACTATTACCGAAGAGGGCACTCCATCGC
TGAAAGAGCAGATGGAGAAAGTGTTTGACGGAATCATGCTACCTAATGAGACAAAAACAATAGAACTGAC
GCTAAACAGTGGCGTCACTGCCATCGGCGTTGTTGCTGCTTACCGTGAAATTGAGCAGGCGGAGTGGAAC
GCGGTTTTTAGCCCGTTACCCAAGAAACGCGTGCAGCCCTGGTATAAAAAATGGTGGTCAGGGAAACAAA
ACGATCCGGTCGTCAAGGTGCGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGACTAA
 Primer design