SecReT6
Protein ID: 123442906
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2690
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2922177..2923604 [-]
Producthypothetical protein
NoteTssC
UniProt IDA1JTM6
KEGG IDyen:YE2690
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-193, Aligned region: 43..469
Protein Sequence: 475 a.a.     [Download]
>gi|123442906|ref|YP_001006881.1| hypothetical protein YE2690 [Yersinia enterocolitica subsp. enterocolitica 8081]
MTKEFKAKSEQTKAAVEGAVKTLAEQALANSVTVSDDAYKSIASIIAEIDSKLSEQINLILHHQEFQSLE
SAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQSPLFKKVYEEEYGQLGGEPYGCLVA
DYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQELSNPRDLTKIFTQNLEYAAWNSLRQS
EDSRYIGLAMPRFLARLPYGIRTNPVDAFHFEETTDGADHGKYVWSNAAYAMAVNINRSFKEYGWCTLIR
GVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGFIPLVHRKNTDYAAFIGAQSLQKPA
EYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDEMQRWLNDWVMNYVDGDPANSSIET
KARRPLAAAEVIVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRMVAKLPSLKDVA
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2923604-2922177 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
TTGACCAAAGAATTCAAGGCTAAGTCTGAGCAGACCAAAGCGGCAGTAGAAGGTGCCGTTAAAACATTGG
CTGAGCAGGCGCTGGCTAATTCGGTAACTGTATCTGATGATGCTTATAAAAGCATTGCCTCTATTATTGC
TGAAATCGACAGTAAATTGTCTGAGCAGATCAATTTGATCTTGCATCATCAAGAGTTTCAGTCTCTGGAA
AGTGCCTGGCGTGGCCTGCACTATTTAGTGAATAACACCGAGACTGATGAGAAATTGAGATTACGTTTTC
TCGACATCTCTAAAGATGAATTACGCCGTAATATGAAGCGTTATAAAGGTGTGGCGTGGGATCAGAGCCC
ATTATTCAAAAAAGTCTATGAAGAAGAGTATGGCCAATTGGGCGGCGAACCTTATGGTTGCCTGGTGGCG
GATTACTACTTTGACCATACTGCGCCTGACGTTGATTTGCTGGCTTCCATCGGTAAGGTTGCTGCTTCTG
CACACGTACCTTTTATCACTGGTGCCGCGCCGTCAGTATTGCAGATGGAATCCTGGCAAGAGCTGTCAAA
TCCGCGTGATTTGACCAAGATCTTCACTCAGAATCTTGAGTATGCTGCCTGGAACTCACTGCGTCAGTCC
GAAGACTCCCGTTATATTGGTCTGGCAATGCCGCGTTTCCTGGCGCGTCTGCCATACGGTATTCGCACTA
ACCCGGTAGATGCCTTCCACTTTGAAGAGACGACTGACGGTGCCGACCATGGCAAATATGTGTGGTCCAA
CGCGGCGTATGCTATGGCTGTTAACATCAACCGTTCATTCAAAGAATATGGCTGGTGTACCCTGATTCGT
GGTGTGGAAAGTGGTGGTGTGGTGGAAGGCTTGCCATGTCATACATTCCCAACTGATGATGGTGGCATTG
ATATGAAGTGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAAGCGGAATTGGCTAAAAATGGCTTTAT
TCCACTGGTGCACAGAAAAAATACTGATTATGCGGCATTTATTGGCGCGCAATCATTGCAAAAACCTGCT
GAATATTACGATTCAGATGCTACAGCTAACGCCAACTTGTCGGCACGTTTGCCTTACCTGTTCGCCTGTT
CACGTTTTGCCCATTACCTGAAATGTATCGTGCGTGACAAAATCGGCTCATTCAAAGAGCGCGATGAGAT
GCAACGCTGGTTGAACGATTGGGTCATGAACTATGTAGATGGCGATCCGGCAAACTCTTCTATCGAGACG
AAAGCACGCCGTCCGTTGGCCGCAGCTGAAGTTATTGTTGAAGATGTTGAAGGTAACCCAGGTTATTACC
AGGCTAAATTCTTCCTGCGCCCACACTTCCAATTGGAAGGTTTGACGGTATCACTGCGCATGGTTGCTAA
ATTACCTTCACTGAAAGATGTTGCGTAA
 Primer design