SecReT6
Protein ID: 123442907
SecReT6 ID171
T6SS typei3
Gene symbol-
Locus tagYE2691
StrainYersinia enterocolitica subsp. enterocolitica 8081
Repliconchromosome [GenBank: NC_008800] [Browse all T6SS(s) in this replicon]
Location [Strand]2923697..2924221 [-]
Producthypothetical protein
NoteTssB
UniProt IDA1JTM7
KEGG IDyen:YE2691
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-59, Aligned region: 11..164
Protein Sequence: 174 a.a.     [Download]
>gi|123442907|ref|YP_001006882.1| hypothetical protein YE2691 [Yersinia enterocolitica subsp. enterocolitica 8081]
MVSKSNSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPSVADRKLLDIDIDNF
DERMKAMKPRVAFAVKNTLTGEGQLMVDITFESLNDFSPDEIAKKVDSLSQLLDARTQLANLQTYMDGKA
GAEELVMKLLKDKSLLATLASAPKTKQSAADAPQ
 
Nucleotide Sequence: 525 bp     [Download]
>gi|123440403|ref|NC_008800.1|:c2924221-2923697 Yersinia enterocolitica subsp. enterocolitica 8081 chromosome, complete genome
ATGGTTAGTAAAAGTAATTCCCAAAAATTTATCGCTCGAAACCGAGCGCCACGCGTACAAATTGAATACG
ATGTGGAAATATATGGTAGTGAGAAAAAGGTTGAATTGCCATTCGTCATGGGCGTGCTGGCTGATTTATC
CGGTAAGCCTCTTGAACCTTTACCTTCAGTAGCAGATAGAAAGCTGCTGGATATTGACATCGATAATTTC
GATGAGCGTATGAAAGCAATGAAACCACGAGTTGCATTTGCTGTGAAAAATACGCTGACGGGTGAAGGCC
AGTTGATGGTGGATATTACTTTTGAGAGCCTGAATGACTTTTCTCCCGATGAAATTGCCAAGAAAGTCGA
TTCTCTGTCTCAATTGTTAGATGCCCGTACTCAATTGGCAAACTTGCAAACCTATATGGATGGCAAGGCA
GGTGCAGAGGAATTAGTAATGAAACTTCTGAAAGACAAATCATTACTGGCAACACTGGCATCCGCACCGA
AAACAAAGCAATCCGCTGCTGATGCTCCACAGTAA
 Primer design